Dataset for protein classical BH3-containing proteins of organism Taeniopygia guttata

[Download (right click)] [Alignment] [Repertoires]

6 sequence(s)

>gnl|bcl2dbpro|A0A674GIP8_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Taeniopygia guttata GN=BMF (length=200 residues).
MDRPSYLEEDYSSLDGLDDDVFHSDDFGLAGQPGEMTATGFFTQNQSYSCLLGRFQLFPLTHCCGPGIRHPEQQDKATQT
LSPSSSSQDVMLPCGVTEEPRRLFYGSAGYRLHVPPAGFVLDPHLQEEPQEGQREARAEVQIARKLQCIADQFHRLHIQR
HQQNRNQVWWQLFLFLHNLALNTEVNRNHTGQRNHWLCLK
>gnl|bcl2dbpro|A0A674GIP8_BMF-03 Bcl2 modifying factor protein OS=[Eukaryota] Taeniopygia guttata GN=BMF (length=180 residues).
MDRPSYLEEDYSSLDGLDDDVFHSDDFGLAGQPGEMTATGFFTQNQSYSCLLGRFQLFPLTHCCGPGIRHPEQQDKATQT
LSPSSSSQDVMLPCGVTEEPRRLFYGSAGYRLHVPPAGFVLDPHLQEEPQEGQREARAEVQIARKLQCIADQFHRLHIQR
VGRTEIKCGGSFFSSYTTWP
>gnl|bcl2dbpro|A0A674GIP8_BMF-02 Bcl2 modifying factor protein OS=[Eukaryota] Taeniopygia guttata GN=BMF (length=191 residues).
MDRPSYLEEDYSSLDGLDDDVFHSDDFGLAGQPGEMTATGFFTQNQSYSCLLGRFQLFPLTHCCGPGIRHPEQQDKATQT
LSPSSSSQDVMLPCGVTEEPRRLFYGSAGYRLHVPPAGFVLDPHLQEEPQEGQREARAEVQIARKLQCIADQFHRLHIQR
QNRNQVWWQLFLFLHNLALNTEVNRNHTGQR
>gnl|bcl2dbpro|A0A674GQ16_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Taeniopygia guttata GN=BAD (length=197 residues).
MLRLDETPEDRGSPPPSPWGGSPSPSQPGTPSPGQRLPPTQNPPPGGTPKPPGGTPKAIFGGPLTPLPPQRRGPGCCRSG
GGAGGGGDPQIGAPPGDPPPARGRSRSAPPVLWAAQRYGRRLRRMSDEFQLQVLPRPRSVGGAPPGGGGWRETLRAWWGS
RRPRPAPPAPPPDRPPPQKPHLGRGAPKCCREWGGGQ
>gnl|bcl2dbpro|A0A674H354_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Taeniopygia guttata GN=BCL2L11 (length=189 residues).
MAKQPPEVKARRDGEGGRLPAAEGPGPGAQLRPGAPAALPGAGPVSAGAAARGPPASPGPFATRSPLFIFVRRSPLLPRS
SSGYFSFDAERSPAPLGCDKATQTPSPPCQALSHCLSAMASRWQSHSPAEEVQPEIWIAQELRRIGDEFNASYCPRRGFL
DQQVGNPQVMILRLLRLLHSIIRLIWRLH
>gnl|bcl2dbpro|A0A674HDV6_PMAIP1-01 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Taeniopygia guttata GN=PMAIP1 (length=78 residues).
MPGRTLRKTAPPAAPAAVECALELTRIGDRWDLRQRLLNLLAKLFCPGTWAARGHGERNGGGPWLCGFGRRGSTDTGR
© 1998-2021Legal notice