Dataset for protein classical BH3-containing proteins of organism Taeniopygia guttata

[Download (right click)] [Edit] [Sequences] [Repertoires]

6 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A674HDV6_PMAIP1-      --------------------------------------------------
A0A674H354_BCL2L11      --MAKQPPEVKARRDGEGGRLPAAEGPGPGAQLRPGAPAALPGAGPVSAG
A0A674GQ16_BAD-01       ----------MLRLDETPEDRGSPPPSPWGGS------------------
A0A674GIP8_BMF-03       MDRPSYLEEDYSSLDGLDDDVFHSDDFGLAGQ------------------
A0A674GIP8_BMF-01       MDRPSYLEEDYSSLDGLDDDVFHSDDFGLAGQ------------------
A0A674GIP8_BMF-02       MDRPSYLEEDYSSLDGLDDDVFHSDDFGLAGQ------------------
                                                                          

A0A674HDV6_PMAIP1-      ----------------------------------------MPG-------
A0A674H354_BCL2L11      AAARGPPASPGPFATRSPLFIFVRRSPLLPRSSSGYFSFDAERSPAPLGC
A0A674GQ16_BAD-01       ---PSP----------------------------S-----QPGTPSPGQR
A0A674GIP8_BMF-03       ---PGEMTATGFFTQNQSYSCLLGRFQLFPLTHCC-----GPGIRHPEQQ
A0A674GIP8_BMF-01       ---PGEMTATGFFTQNQSYSCLLGRFQLFPLTHCC-----GPGIRHPEQQ
A0A674GIP8_BMF-02       ---PGEMTATGFFTQNQSYSCLLGRFQLFPLTHCC-----GPGIRHPEQQ
                                                                          

A0A674HDV6_PMAIP1-      ---------------------------------RTLRKTAPP--------
A0A674H354_BCL2L11      DKATQTPSP---------PCQAL--SHCLSAMASRWQSHSPA--------
A0A674GQ16_BAD-01       LPPTQNPPPGGTPKP---PGGT---PKAIFGGPL---TPLPPQRRGPGCC
A0A674GIP8_BMF-03       DKATQTLSPSSSSQDVMLPCGVTEEPRRLFYGSAGYRLHVPP--------
A0A674GIP8_BMF-01       DKATQTLSPSSSSQDVMLPCGVTEEPRRLFYGSAGYRLHVPP--------
A0A674GIP8_BMF-02       DKATQTLSPSSSSQDVMLPCGVTEEPRRLFYGSAGYRLHVPP--------
                                                                *.        

A0A674HDV6_PMAIP1-      ----------------------------AAPAAV-----ECALELTRIGD
A0A674H354_BCL2L11      ---------------------------EEVQPEI-----WIAQELRRIGD
A0A674GQ16_BAD-01       RSGGGAGGGGDPQIGAPPGDPPPARGRSRSAPPVLWAAQRYGRRLRRMSD
A0A674GIP8_BMF-03       -----AGFVLDPHLQEEPQE-----GQREARAEV-----QIARKLQCIAD
A0A674GIP8_BMF-01       -----AGFVLDPHLQEEPQE-----GQREARAEV-----QIARKLQCIAD
A0A674GIP8_BMF-02       -----AGFVLDPHLQEEPQE-----GQREARAEV-----QIARKLQCIAD
                                                       . :       .  *  :.*

A0A674HDV6_PMAIP1-      RWDLR--------------------------QRLLNLLAKLFCPGTWAAR
A0A674H354_BCL2L11      EFNASYCPRRGFLDQQVGNPQVMILRLLRLLHSIIRLIWRLH--------
A0A674GQ16_BAD-01       EFQLQVLPRPRSVGGAPPGGGG--------WRETLRAWWGSRRPRPAPPA
A0A674GIP8_BMF-03       QFHRLHIQRVG--------------------RTEIKCGGSFFSSY-----
A0A674GIP8_BMF-01       QFHRLHIQRHQ--------------------QNRNQVWWQLFLFL-----
A0A674GIP8_BMF-02       QFHRLHIQR----------------------QNRNQVWWQLFLFL-----
                         :                             .   .              

A0A674HDV6_PMAIP1-      GHGERNGGGPWLCGFGRRGSTDTGR---
A0A674H354_BCL2L11      ----------------------------
A0A674GQ16_BAD-01       PPPDRPPPQKPHLGRGAPKCCREWGGGQ
A0A674GIP8_BMF-03       ----TTWP--------------------
A0A674GIP8_BMF-01       ----HNLALNTEVNRNHTGQRNHWLCLK
A0A674GIP8_BMF-02       ----HNLALNTEVNRNHTGQR-------
                                                    

© 1998-2020Legal notice