Dataset for protein Bim of organism Suricata suricatta

[Download (right click)] [Alignment] [Repertoires]

4 sequence(s)

>gnl|bcl2dbpro|A0A673SRF7_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Suricata suricatta GN=BCL2L11 (length=197 residues).
MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTQRQGNPEGEGDRCPQGSPQGPLAPPASPGPFATRSPLFIFVR
RSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAINHYLSAMASMRQSQAAPADMRPEIWIAQELRRIGDEFNAY
YPRRVFLNNYQAAEAHPQMIILRLLRYIVRLVWRLQR
>gnl|bcl2dbpro|A0A673SRF7_BCL2L11-04 BCL2-like 11 protein OS=[Eukaryota] Suricata suricatta GN=BCL2L11 (length=88 residues).
MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTQRQASMRQSQAAPADMRPEIWIAQELRRIGDEFNAYYPRRLA
GVPASSIL
>gnl|bcl2dbpro|A0A673SRF7_BCL2L11-03 BCL2-like 11 protein OS=[Eukaryota] Suricata suricatta GN=BCL2L11 (length=167 residues).
MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTQRQGNPEGEGDRCPQGSPQGPLAPPASPGPFATRSPLFIFVR
RSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAINHYLSAMASMRQSQAAPADMRPEIWIAQELRRIGDEFNAY
YPRRLEQ
>gnl|bcl2dbpro|A0A673SRF7_BCL2L11-02 BCL2-like 11 protein OS=[Eukaryota] Suricata suricatta GN=BCL2L11 (length=170 residues).
MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTQRQDRSPAPMSCDKSTQTPSPPCQAINHYLSAMASMRQSQAA
PADMRPEIWIAQELRRIGDEFNAYYPRRGEGPSMFTEPKRVCASAKAAVTEYDRLQGRECINDRTAFIQSWRPEAWELGL
AAPVCCARSF
© 1998-2020Legal notice