Dataset for protein Bim of organism Suricata suricatta

[Download (right click)] [Edit] [Sequences] [Repertoires]

4 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A673SRF7_BCL2L11      MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTQRQ---------
A0A673SRF7_BCL2L11      MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTQRQ---------
A0A673SRF7_BCL2L11      MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTQRQGNPEGEGDR
A0A673SRF7_BCL2L11      MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTQRQGNPEGEGDR
                        *****************************************         

A0A673SRF7_BCL2L11      --------------------------------------------------
A0A673SRF7_BCL2L11      -----------------------------------------------DRS
A0A673SRF7_BCL2L11      CPQGSPQGPLAPPASPGPFATRSPLFIFVRRSSLLSRSSSGYFSFDTDRS
A0A673SRF7_BCL2L11      CPQGSPQGPLAPPASPGPFATRSPLFIFVRRSSLLSRSSSGYFSFDTDRS
                                                                          

A0A673SRF7_BCL2L11      ---------------------------ASMRQSQAAPADMRPEIWIAQEL
A0A673SRF7_BCL2L11      PAPMSCDKSTQTPSPPCQAINHYLSAMASMRQSQAAPADMRPEIWIAQEL
A0A673SRF7_BCL2L11      PAPMSCDKSTQTPSPPCQAINHYLSAMASMRQSQAAPADMRPEIWIAQEL
A0A673SRF7_BCL2L11      PAPMSCDKSTQTPSPPCQAINHYLSAMASMRQSQAAPADMRPEIWIAQEL
                                                   ***********************

A0A673SRF7_BCL2L11      RRIGDEFNAYYPRRLAGVPASSIL--------------------------
A0A673SRF7_BCL2L11      RRIGDEFNAYYPRRGEGPSMFTEPKRVCASAKAAVTEYDRLQGRECINDR
A0A673SRF7_BCL2L11      RRIGDEFNAYYPRRVFLNNYQAAEAHPQMIILRLLRYIVRL---------
A0A673SRF7_BCL2L11      RRIGDEFNAYYPR-------------------------------------
                        *************                                     

A0A673SRF7_BCL2L11      --------------------------
A0A673SRF7_BCL2L11      TAFIQSWRPEAWELGLAAPVCCARSF
A0A673SRF7_BCL2L11      -----VWRLQR---------------
A0A673SRF7_BCL2L11      -------RLEQ---------------
                                                  

© 1998-2020Legal notice