Dataset for protein Puma of organism Suricata suricatta

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bcl2dbpro|A0A673UKJ9_BBC3-01 BCL2 binding component 3 protein OS=[Eukaryota] Suricata suricatta GN=BBC3 (length=130 residues).
MYSSAGAARACPWKVGASLVPRVPRQICGPQPSLSPAEPHLESPVPSAPGALAGGPTQAAPGIRGEEEQWAREIGAQLRR
MADDLNALYERRRQEEQQRHRPSPWRVLYNLIMGLLPLPRARGAPEMEPN
>gnl|bcl2dbpro|A0A673UKJ9_BBC3-02 BCL2 binding component 3 protein OS=[Eukaryota] Suricata suricatta GN=BBC3 (length=100 residues).
MYSSAGAARACPWKVGASLVPRVPRQICETRGAAATPPLTLEGPVQSHHGTPALTQGPRSPGDGAQLGACTRPVDVGDLG
GRTLPPPDALASAGDFFCTM
© 1998-2020Legal notice