Dataset for protein Puma of organism Suricata suricatta

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A673UKJ9_BBC3-01      MYSSAGAARACPWKVGASLVPRVPRQICGPQPSLSPAEPHLESPVPSAPG
A0A673UKJ9_BBC3-02      MYSSAGAARACPWKVGASLVPRVPRQICETRGAAATPPLTLEGPVQSHHG
                        **************************** .. : :..   **.** *  *

A0A673UKJ9_BBC3-01      --ALAGGPTQAAPGIRGEEEQWAREIGAQLRRMADDLNALYERRRQEEQQ
A0A673UKJ9_BBC3-02      TPALTQGPRSPGDGAQLGACTRPVDVGDLGGRTLPPPDAL----------
                          **: ** ... * .     .. ::*    *     :**          

A0A673UKJ9_BBC3-01      RHRPSPWRVLYNLIMGLLPLPRARGAPEMEPN
A0A673UKJ9_BBC3-02      ---ASAGDFFCTM-------------------
                           .*.  .: .:                   

© 1998-2020Legal notice