Dataset for protein Bmf of organism Sinocyclocheilus rhinocerous

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bcl2dbpro|A0A673HDR4_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Sinocyclocheilus rhinocerous GN=BMF (length=129 residues).
MDEDEDDVRRKGLQRWPSSRVQIKQTETAGRPPLSPSGMLPCRVHVEPRRFLYGNTGLLLLAPPSRSRPPDVVLRQNLRM
MDPAESVETLIGQKLQLIGDQFYQEHMMVTLLYTKVFSVCRVCFGRTVS
>gnl|bcl2dbpro|A0A673JJ10_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Sinocyclocheilus rhinocerous GN=BMF (length=203 residues).
MDDEEDEQLPHCCETPLRNKSSENRDGPRGEVGQTANRHGRFEDRSTQTARTVLNSARDGDMAPFQEGPRALFHGNAGFR
SHFPALFEPVPDSTQNAEEDGGTPEEKEDERDVGISVEIQIGRKLREMGDQFQQEHLQLVILISDETSFFSSSLWFSLQW
FLSRCAMTSSSVISMLHMQMLSGRDDIIFGLPELYCVFVVVKN
© 1998-2020Legal notice