Dataset for protein Bmf of organism Sinocyclocheilus rhinocerous

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A673HDR4_BMF-01      MDEDEDD---------VRRKGLQRWPSSRVQIKQTET-----AGRPPLSP
A0A673JJ10_BMF-01      MDDEEDEQLPHCCETPLRNKSSENRDGPRGEVGQTANRHGRFEDRSTQTA
                       **::**:         :*.*. :.. ..* :: ** .      .*.. :.

A0A673HDR4_BMF-01      SGMLP-------CRVHVEPRRFLYGNTGLLLLAPPSRSRPPDVVLRQNLR
A0A673JJ10_BMF-01      RTVLNSARDGDMAPFQEGPRALFHGNAGFRSHFPALFEPVPDSTQNAEED
                         :*        . .:  ** :::**:*:    *.  .  ** . . :  

A0A673HDR4_BMF-01      MMDPAE---------SVETLIGQKLQLIGDQFYQEHMMVTLLYTK-----
A0A673JJ10_BMF-01      GGTPEEKEDERDVGISVEIQIGRKLREMGDQFQQEHLQLVILISDETSFF
                          * *         ***  **.**. :**** ***: :.:* :.     

A0A673HDR4_BMF-01      ----------VFSVCRVCFGRTVS--------------------------
A0A673JJ10_BMF-01      SSSLWFSLQWFLSRCAMTSSSVISMLHMQMLSGRDDIIFGLPELYCVFVV
                                 .:* * :  . .:*                          

A0A673HDR4_BMF-01      ---
A0A673JJ10_BMF-01      VKN
                          

© 1998-2020Legal notice