Dataset for protein Bim of organism Sinocyclocheilus grahami

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bcl2dbpro|A0A672L1R2_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Sinocyclocheilus grahami GN=BCL2L11 (length=176 residues).
MSDTSREQTPGRGSGESAGGAAVLGSGHFDFPQPSDGDPLRGGIAMSSSHQSRSPMSRTFSRSSSGYFSVDSDSVPSSPL
MPNISEAQDGQNDEVWSAEPSHQHVQMAAPVGAMGPEMAVARELRRIGDEFNRLYCQGAGAGGNNAAQLRAPNEHAIIMW
MNDLIGRVVQFFLRRR
>gnl|bcl2dbpro|A0A672PQD1_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Sinocyclocheilus grahami GN=BCL2L11 (length=177 residues).
MSDTSSREQTPGRGSGESAGGAAVLGSGHFDFPQPSDGDPLRGGIAMSSSHQSRSPMCRTFSRSSSGYFSVDSDSVPGSP
LMPNISEAQDGPNDEVWFAEPSHQHAQMAAPVGAMGPEMAVARELRRIGDEFNRLYCQGAGAGGNNGAQLHAPNEHAIIM
WMNDLIGRVVQFFLRRR
© 1998-2020Legal notice