Dataset for protein Bim of organism Sinocyclocheilus grahami

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A672L1R2_BCL2L11      MSDT-SREQTPGRGSGESAGGAAVLGSGHFDFPQPSDGDPLRGGIAMSSS
A0A672PQD1_BCL2L11      MSDTSSREQTPGRGSGESAGGAAVLGSGHFDFPQPSDGDPLRGGIAMSSS
                        **** *********************************************

A0A672L1R2_BCL2L11      HQSRSPMSRTFSRSSSGYFSVDSDSVPSSPLMPNISEAQDGQNDEVWSAE
A0A672PQD1_BCL2L11      HQSRSPMCRTFSRSSSGYFSVDSDSVPGSPLMPNISEAQDGPNDEVWFAE
                        *******.*******************.************* ***** **

A0A672L1R2_BCL2L11      PSHQHVQMAAPVGAMGPEMAVARELRRIGDEFNRLYCQGAGAGGNNAAQL
A0A672PQD1_BCL2L11      PSHQHAQMAAPVGAMGPEMAVARELRRIGDEFNRLYCQGAGAGGNNGAQL
                        *****.****************************************.***

A0A672L1R2_BCL2L11      RAPNEHAIIMWMNDLIGRVVQFFLRRR
A0A672PQD1_BCL2L11      HAPNEHAIIMWMNDLIGRVVQFFLRRR
                        .**************************

© 1998-2020Legal notice