Dataset for protein Bad of organism Sinocyclocheilus grahami

[Download (right click)] [Alignment] [Repertoires]

5 sequence(s)

>gnl|bcl2dbpro|A0A672LB88_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Sinocyclocheilus grahami GN=BAD (length=147 residues).
MDNTLHDHQDDSSTWNDKKKGREETIKNQGQHQDQTLPNISPQGRVRLYSESQVYTVSRWQEAEPQDGALVEENGGTGDG
LPFRGRSQSAPAALWKAKKYGRQLRRMSDEFDTWLDKGEVKRANSQKQTYRGWFSFLWSSKEEEGRE
>gnl|bcl2dbpro|A0A672R7P6_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Sinocyclocheilus grahami GN=BAD (length=147 residues).
MDKRLHDHRNDSSTLNDRKKGREETINTRGQHQDQTLPNISPQGRVRLYSESQVYMVSRWQEAEPQDGASAEENGGTGDG
LPFRGRSQSAPAALWKAKKYGRQLRRMSDEFDTWLDKGEVKRANSQKQTYRGWFSFLWSSKDEEGRE
>gnl|bcl2dbpro|A0A672RGH0_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Sinocyclocheilus grahami GN=BAD (length=152 residues).
MAQMFSISDNESETETSEDCEESGQVKNNSGSPQRTQHLAVPGRLKGEQLGRHRNLSMNDEDLLETGAADEGDLVGGDPF
RPRSRSAPPALWAAKKYGQQLRRMSDEFDILLDKGMKRVKSAGTTRQMRQSPSWLAFLWSHKESDAESRPAE
>gnl|bcl2dbpro|A0A672SAE4_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Sinocyclocheilus grahami GN=BAD (length=153 residues).
MAQMFSISDNESDTETSEDCEDSDLTKNNSGSPQKTNHDLAVPDRLKGEQLGRHRNLSMNDEDLLETGAADEGDLVGGDP
FRPRSRSAPPALWAAKKYGRQLRRMSDEFDILLDKGMKRVKSAGTTRQMQQSPSWFAFLWSHKESDAESRPAE
>gnl|bcl2dbpro|A0A672SAE4_BAD-02 BCL2-associated agonist of cell death protein OS=[Eukaryota] Sinocyclocheilus grahami GN=BAD (length=153 residues).
MAQMFSISDNESDTETSEDCEDSDLTKNNSGSPQKTNHDLAVPDRLKGEQLGRHRNLSMNDEDLLETGAADEGDLVGGDP
FRPRSRSAPPALWAAKKYGRQLRRMSDEFDILLDKGMKRVKSAGTTRQMQQSPSWFAFLWSHKESDAESRPAE
© 1998-2020Legal notice