Dataset for protein Bad of organism Sinocyclocheilus grahami

[Download (right click)] [Edit] [Sequences] [Repertoires]

5 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A672LB88_BAD-01      MDNTLHDHQDDSSTWNDKKKGREETIKNQGQHQDQTLPNISPQGRVRLYS
A0A672R7P6_BAD-01      MDKRLHDHRNDSSTLNDRKKGREETINTRGQHQDQTLPNISPQGRVRLYS
A0A672RGH0_BAD-01      MAQMFSISDNESETETSEDCEESGQVKNNSGSPQRTQH-LAVPGRLKGEQ
A0A672SAE4_BAD-01      MAQMFSISDNESDTETSEDCEDSDLTKNNSGSPQKTNHDLAVPDRLKGEQ
A0A672SAE4_BAD-02      MAQMFSISDNESDTETSEDCEDSDLTKNNSGSPQKTNHDLAVPDRLKGEQ
                       * : :    ::*.* .. .   .   :...   :.*   ::  .*:.  .

A0A672LB88_BAD-01      ESQVYTVSRWQEAEPQDGALVEENGGTGDGLPFRGRSQSAPAALWKAKKY
A0A672R7P6_BAD-01      ESQVYMVSRWQEAEPQDGASAEENGGTGDGLPFRGRSQSAPAALWKAKKY
A0A672RGH0_BAD-01      LGRHRNLSMNDEDLLETGAA--DEGDLVGGDPFRPRSRSAPPALWAAKKY
A0A672SAE4_BAD-01      LGRHRNLSMNDEDLLETGAA--DEGDLVGGDPFRPRSRSAPPALWAAKKY
A0A672SAE4_BAD-02      LGRHRNLSMNDEDLLETGAA--DEGDLVGGDPFRPRSRSAPPALWAAKKY
                        ..   :* .:*   : **   ::*.  .* *** **.***.*** ****

A0A672LB88_BAD-01      GRQLRRMSDEFDTWLDKG--EVKRANSQKQTYR--GWFSFLWSSKEEEGR
A0A672R7P6_BAD-01      GRQLRRMSDEFDTWLDKG--EVKRANSQKQTYR--GWFSFLWSSKDEEGR
A0A672RGH0_BAD-01      GQQLRRMSDEFDILLDKGMKRVKSAGTTRQMRQSPSWLAFLWSHKESDAE
A0A672SAE4_BAD-01      GRQLRRMSDEFDILLDKGMKRVKSAGTTRQMQQSPSWFAFLWSHKESDAE
A0A672SAE4_BAD-02      GRQLRRMSDEFDILLDKGMKRVKSAGTTRQMQQSPSWFAFLWSHKESDAE
                       *.**********  ****   ** *.: .*  .  .*::**** *:.:. 

A0A672LB88_BAD-01      E----
A0A672R7P6_BAD-01      E----
A0A672RGH0_BAD-01      SRPAE
A0A672SAE4_BAD-01      SRPAE
A0A672SAE4_BAD-02      SRPAE
                       .    

© 1998-2020Legal notice