Dataset for protein Bmf of organism Sinocyclocheilus anshuiensis

[Download (right click)] [Alignment] [Repertoires]

3 sequence(s)

>gnl|bcl2dbpro|A0A671M0H4_BMF-02 Bcl2 modifying factor protein OS=[Eukaryota] Sinocyclocheilus anshuiensis GN=BMF (length=159 residues).
MDEDEDDVRRKGLQRWPSSRVQIKQTETAGTPPVSPSGMLPCRVHVEPTRFLYGNAGLLLLASPSRSQPPDVVLRQDLRM
MDPAVARPERSVETLIGQKLQLIGDQFYQEHMMVSRVGSGDPVNVFSVRWIIIALCLALALVYTKAFSMCRVCFGRTVS
>gnl|bcl2dbpro|A0A671M0H4_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Sinocyclocheilus anshuiensis GN=BMF (length=159 residues).
MDEDEDDVRRKGLQRWPSSRVQIKQTETAGTPPVSPSGMLPCRVHVEPTRFLYGNAGLLLLASPSRSQPPDVVLRQDLRM
MDPAVARPERSVETLIGQKLQLIGDQFYQEHMMVSRVGSGDPVNVFSVRWIIIALCLALALVYTKAFSMCRVCFGRTVS
>gnl|bcl2dbpro|A0A671MNR9_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Sinocyclocheilus anshuiensis GN=BMF (length=143 residues).
MDEDEDDVRRKGLQHWPSSRVQIKQTETAGRPPLSPSGMLPCRVNVEPRRFLYGNTGLLLLAPPSRSRPPDVVLRQNLRM
MDPAESVETLIGQKLQLIGDQFYQEHMMHHRNQRNREPLWWRVAVAFYTLLFGREPNARANRR
© 1998-2020Legal notice