Dataset for protein Bmf of organism Sinocyclocheilus anshuiensis

[Download (right click)] [Edit] [Sequences] [Repertoires]

3 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A671M0H4_BMF-02      MDEDEDDVRRKGLQRWPSSRVQIKQTETAGTPPVSPSGMLPCRVHVEPTR
A0A671M0H4_BMF-01      MDEDEDDVRRKGLQRWPSSRVQIKQTETAGTPPVSPSGMLPCRVHVEPTR
A0A671MNR9_BMF-01      MDEDEDDVRRKGLQHWPSSRVQIKQTETAGRPPLSPSGMLPCRVNVEPRR
                       **************.*************** **:**********:*** *

A0A671M0H4_BMF-02      FLYGNAGLLLLASPSRSQPPDVVLRQDLRMMDPAVARPERSVETLIGQKL
A0A671M0H4_BMF-01      FLYGNAGLLLLASPSRSQPPDVVLRQDLRMMDPAVARPERSVETLIGQKL
A0A671MNR9_BMF-01      FLYGNTGLLLLAPPSRSRPPDVVLRQNLRMMDPA-----ESVETLIGQKL
                       *****:******.****.********:*******      **********

A0A671M0H4_BMF-02      QLIGDQFYQEHMMVSRVGSGDPVNVFSVRWIIIALCLALALVYTKAFSMC
A0A671M0H4_BMF-01      QLIGDQFYQEHMMVSRVGSGDPVNVFSVRWIIIALCLALALVYTKAFSMC
A0A671MNR9_BMF-01      QLIGDQFYQEHMMHHR----NQRNREPLWWRV-------------AVAFY
                       *************  *    :  *  .:.* :             *.:: 

A0A671M0H4_BMF-02      RVCFGRTVS------
A0A671M0H4_BMF-01      RVCFGRTVS------
A0A671MNR9_BMF-01      TLLFGREPNARANRR
                        : ***  .      

© 1998-2020Legal notice