Dataset for protein Bim of organism Sinocyclocheilus anshuiensis

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bcl2dbpro|A0A671M057_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Sinocyclocheilus anshuiensis GN=BCL2L11 (length=176 residues).
MSDTSREQTPGRGSGESAGGGAVVRSGYFDFPQPSDGDPLRGGISMSNSHQSRSPMCRTFSRSSSGYFSVDSDSVPGSPL
MPNISEAQDGQNDEVWFAEPSHQHAQMAAPVGAMGPEMAVARELRRIGDEFNRLYCQGAGAGGNNGAQLRAPNEHAIIMW
MNDLIGRVVQFFLRRR
>gnl|bcl2dbpro|A0A671SJ75_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Sinocyclocheilus anshuiensis GN=BCL2L11 (length=180 residues).
VSDTTTQTLANGPASRGSGESAGGGAVLRSGHFDFPQPSDGDPLRGGIAMSNSHQSRSPMSRTFSRSSSGYFSVDSDSMP
SSPLMPNISEAQDGQNDEVWSAEPSHQHVQMAAPVGAMGPEMAVARELRRIGDEFNRLYCQGAGAGGNNAAQLRAPNEHA
IIMWMNDLIGRVVQFFLRRR
© 1998-2020Legal notice