Dataset for protein Bim of organism Sinocyclocheilus anshuiensis

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A671M057_BCL2L11      MSDTSREQ----TPGRGSGESAGGGAVVRSGYFDFPQPSDGDPLRGGISM
A0A671SJ75_BCL2L11      VSDTTTQTLANGPASRGSGESAGGGAVLRSGHFDFPQPSDGDPLRGGIAM
                        :***: :     ...************:***:****************:*

A0A671M057_BCL2L11      SNSHQSRSPMCRTFSRSSSGYFSVDSDSVPGSPLMPNISEAQDGQNDEVW
A0A671SJ75_BCL2L11      SNSHQSRSPMSRTFSRSSSGYFSVDSDSMPSSPLMPNISEAQDGQNDEVW
                        **********.*****************:*.*******************

A0A671M057_BCL2L11      FAEPSHQHAQMAAPVGAMGPEMAVARELRRIGDEFNRLYCQGAGAGGNNG
A0A671SJ75_BCL2L11      SAEPSHQHVQMAAPVGAMGPEMAVARELRRIGDEFNRLYCQGAGAGGNNA
                         *******.****************************************.

A0A671M057_BCL2L11      AQLRAPNEHAIIMWMNDLIGRVVQFFLRRR
A0A671SJ75_BCL2L11      AQLRAPNEHAIIMWMNDLIGRVVQFFLRRR
                        ******************************

© 1998-2020Legal notice