Dataset for protein Bad of organism Sinocyclocheilus anshuiensis

[Download (right click)] [Alignment] [Repertoires]

4 sequence(s)

>gnl|bcl2dbpro|A0A671NP27_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Sinocyclocheilus anshuiensis GN=BAD (length=153 residues).
MAQMFSISDNESDTETSEDCEDSDLTKNNSGSPQKTNHDLAVPDRLKGEQLGRHRNLSMNDENLLETGAADEGDLVGSDP
FRPRSRSAPPALWAAKKYGRQLRRMSDEFDILLDKGMKRVKSAGTTRQMQQSPSWFAFLWSHKESDAESRPAE
>gnl|bcl2dbpro|A0A671PX91_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Sinocyclocheilus anshuiensis GN=BAD (length=147 residues).
MDNTLHDHQDDSSTWNDKKKGREETIKNQGQHQDQTLPNISPQGRVRLYSESQVYTVSRWQEAEPQDGALAEENGGTGDG
LPFRGRSQSAPAALWKAKKYGRQLRRMSDEFDTWLDKGEVKRANSQKQTYRGWFSFLWSPKEEEGRE
>gnl|bcl2dbpro|A0A671RUV0_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Sinocyclocheilus anshuiensis GN=BAD (length=152 residues).
MAQMFSISDNESETETSEDCEESGQAKNNSGSPQRKQHLAVPDRLKGEQLGRHRNLSMNDEDLLETGAADEGDLVGGDPF
RPRSRSAPPALWAAKKYGQQLRRMSDEFDILLDKGMKRVKSAGTTRQMRQSPSWLAFLWSHKESDAESRPAE
>gnl|bcl2dbpro|A0A671SBB4_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Sinocyclocheilus anshuiensis GN=BAD (length=147 residues).
MDKRLHDHQNDSSTLNDKKKGREETINTHGQHQDQTLPNISPQGRVRFYSESQVYMVSRWQEAEPQDGASAEENGGTGDG
LPFRGRSQSAPAALWKAKKYGRQLRRMSDEFDTWLDKGEVKRANSQKQTYRGWFSFLLSSKEEEGRE
© 1998-2020Legal notice