Dataset for protein Bad of organism Sinocyclocheilus anshuiensis

[Download (right click)] [Edit] [Sequences] [Repertoires]

4 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A671PX91_BAD-01      MDNTLHDHQDDSSTWNDKKKGREETIKNQGQHQDQTLPNISPQGRVRLYS
A0A671SBB4_BAD-01      MDKRLHDHQNDSSTLNDKKKGREETINTHGQHQDQTLPNISPQGRVRFYS
A0A671NP27_BAD-01      MAQMFSISDNESDTETSEDCEDSDLTKNNSGSPQKTNHDLAVPDRLKGEQ
A0A671RUV0_BAD-01      MAQMFSISDNESETETSEDCEESGQAKNNSGSPQRKQH-LAVPDRLKGEQ
                       * : :   :::*.* ..:.   .   :.:.   :..   ::  .*:.  .

A0A671PX91_BAD-01      ESQVYTVSRWQEAEPQDGALAEENGGTGDGLPFRGRSQSAPAALWKAKKY
A0A671SBB4_BAD-01      ESQVYMVSRWQEAEPQDGASAEENGGTGDGLPFRGRSQSAPAALWKAKKY
A0A671NP27_BAD-01      LGRHRNLSMNDENLLETGAADEGDLVGSD--PFRPRSRSAPPALWAAKKY
A0A671RUV0_BAD-01      LGRHRNLSMNDEDLLETGAADEGDLVGGD--PFRPRSRSAPPALWAAKKY
                        ..   :* .:*   : **  * :   .*  *** **.***.*** ****

A0A671PX91_BAD-01      GRQLRRMSDEFDTWLDKG--EVKRANSQKQTYR--GWFSFLWSPKEEEGR
A0A671SBB4_BAD-01      GRQLRRMSDEFDTWLDKG--EVKRANSQKQTYR--GWFSFLLSSKEEEGR
A0A671NP27_BAD-01      GRQLRRMSDEFDILLDKGMKRVKSAGTTRQMQQSPSWFAFLWSHKESDAE
A0A671RUV0_BAD-01      GQQLRRMSDEFDILLDKGMKRVKSAGTTRQMRQSPSWLAFLWSHKESDAE
                       *.**********  ****   ** *.: .*  .  .*::** * **.:. 

A0A671PX91_BAD-01      E----
A0A671SBB4_BAD-01      E----
A0A671NP27_BAD-01      SRPAE
A0A671RUV0_BAD-01      SRPAE
                       .    

© 1998-2020Legal notice