Dataset for protein classical BH3-containing proteins of organism Sarcophilus harrisii

[Download (right click)] [Alignment] [Repertoires]

8 sequence(s)

>gnl|bcl2dbpro|A0A7N4NUH6_BCL2L11-04 BCL2-like 11 protein OS=[Eukaryota] Sarcophilus harrisii GN=BCL2L11 (length=103 residues).
MAKQPSDLNSECDREGGQLQPTERPTQPQLRPGAPTSIQTQYQASMRQSQSIPADMRPEIWIAQELRRIGDEFNASYPRR
NVIVTMWKFTERVLSIDKYIKVL
>gnl|bcl2dbpro|A0A7N4NUH6_BCL2L11-03 BCL2-like 11 protein OS=[Eukaryota] Sarcophilus harrisii GN=BCL2L11 (length=182 residues).
MAKQPSDLNSECDREGGQLQPTERPTQPQLRPGAPTSIQTQYQGNSGEGDSCSPSSPQGPFAPPTSPSPFATRSPLFIFV
RRSPLLPRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQSQSIPADMRPEIWIAQELRRIGDEFNA
SYPRRAVWHGFKSFGIGVGSQL
>gnl|bcl2dbpro|A0A7N4NUH6_BCL2L11-02 BCL2-like 11 protein OS=[Eukaryota] Sarcophilus harrisii GN=BCL2L11 (length=203 residues).
MAKQPSDLNSECDREGGQLQPTERPTQPQLRPGAPTSIQTQYQGNSGEGDSCSPSSPQGPFAPPTSPSPFATRSPLFIFV
RRSPLLPRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMGKQDHASMRQSQSIPADMRPEIWIAQELRRIG
DEFNASYPRRGFLDNNYQAADDHHQMVILRLLHYIIRLVWRMQ
>gnl|bcl2dbpro|A0A7N4NUH6_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Sarcophilus harrisii GN=BCL2L11 (length=138 residues).
MAKQPSDLNSECDREGGQLQPTERPTQPQLRPGAPTSIQTQYQDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMGKQDHAS
MRQSQSIPADMRPEIWIAQELRRIGDEFNASYPRRNVIVTMWKFTERVLSIDKYIKVL
>gnl|bcl2dbpro|A0A7N4PJP2_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Sarcophilus harrisii GN=BMF (length=184 residues).
MESPHYVEELEDDVFHPEDSEPGAQPGGLTSPALFAQSQPDYMLDGLQLFPLTHCCGPGLRSVGQEDKATQTLSPASPSQ
GVMLPCGVTEEPHRLFYGNAGYRLPLPANFPSSLRLGAEPPEEQWEHRAEVQIARKLQCIADQFHRLHMQRHQQNQNHVW
WQILLFLHNLALNREENRNGAGPR
>gnl|bcl2dbpro|G3VRY3_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Sarcophilus harrisii GN=BAD (length=157 residues).
MFQISEFEPSEPGEDPSASTAPSLAPLRPGPRAAPGAHHHEGAGAGRPRLISYPPLREGSREASPEAEAEAEQSEGEEER
GLFRGRSSSAPPILWAARHYGSELRRMSDEFHCTFKGLPRPKSAGTASQMRRSHGWTRTFQSWFGRNLGKGSVGPSH
>gnl|bcl2dbpro|G3VRY3_BAD-02 BCL2-associated agonist of cell death protein OS=[Eukaryota] Sarcophilus harrisii GN=BAD (length=157 residues).
MFQISEFEPSEPGEDPSASTAPSLAPLRPGPRAAPGAHHHEGAGAGRPRLISYPPLREGSREASPEAEAEAEQSEGEEER
GLFRGRSSSAPPILWAARHYGSELRRMSDEFHCTFKGLPRPKSAGTASQMRRSHGWTRTFQSWFGRNLGKGSVGPSH
>gnl|bcl2dbpro|G3VRY3_BAD-03 BCL2-associated agonist of cell death protein OS=[Eukaryota] Sarcophilus harrisii GN=BAD (length=157 residues).
MFQISEFEPSEPGEDPSASTAPSLAPLRPGPRAAPGAHHHEGAGAGRPRLISYPPLREGSREASPEAEAEAEQSEGEEER
GLFRGRSSSAPPILWAARHYGSELRRMSDEFHCTFKGLPRPKSAGTASQMRRSHGWTRTFQSWFGRNLGKGSVGPSH
© 1998-2022Legal notice