Dataset for protein classical BH3-containing proteins of organism Sarcophilus harrisii

[Download (right click)] [Edit] [Sequences] [Repertoires]

8 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A7N4PJP2_BMF-01       -----MESPHYVE---ELEDDVFHPED--SEPGAQPGG------------
A0A7N4NUH6_BCL2L11      ----MAKQPSDLNSECDREGGQLQPTERPTQPQLRPGAPTSIQTQYQGNS
A0A7N4NUH6_BCL2L11      ----MAKQPSDLNSECDREGGQLQPTERPTQPQLRPGAPTSIQTQYQGNS
G3VRY3_BAD-03           MFQISEFEPSE-------PGEDPSASTAPSLAPLRPGPRAAPGAHHH---
G3VRY3_BAD-02           MFQISEFEPSE-------PGEDPSASTAPSLAPLRPGPRAAPGAHHH---
G3VRY3_BAD-01           MFQISEFEPSE-------PGEDPSASTAPSLAPLRPGPRAAPGAHHH---
A0A7N4NUH6_BCL2L11      ----MAKQPSDLNSECDREGGQLQPTERPTQPQLRPGAPTSIQTQYQ---
A0A7N4NUH6_BCL2L11      ----MAKQPSDLNSECDREGGQLQPTERPTQPQLRPGAPTSIQTQYQ---
                               .*          .    .    : .  .**             

A0A7N4PJP2_BMF-01       -----------------LTSPALFAQSQPDYMLDGLQLFPLTHCCGPGLR
A0A7N4NUH6_BCL2L11      GEGDSCSPSSPQGPFAPPTSPSPFATRSPLFIF--VRRSPLLPRSSSGYF
A0A7N4NUH6_BCL2L11      GEGDSCSPSSPQGPFAPPTSPSPFATRSPLFIF--VRRSPLLPRSSSGYF
G3VRY3_BAD-03           --------------------------------------------------
G3VRY3_BAD-02           --------------------------------------------------
G3VRY3_BAD-01           --------------------------------------------------
A0A7N4NUH6_BCL2L11      --------------------------------------------------
A0A7N4NUH6_BCL2L11      --------------------------------------------------
                                                                          

A0A7N4PJP2_BMF-01       SVGQEDKATQTLSPASPSQGVMLPCGVTEEPHRLFYGNAGYRLPLPANFP
A0A7N4NUH6_BCL2L11      SF-DTDRSPAPMSCDKSTQTPSPPCQAFNH----------YLSAM-----
A0A7N4NUH6_BCL2L11      SF-DTDRSPAPMSCDKSTQTPSPPCQAFNH----------YLSAMGKQDH
G3VRY3_BAD-03           -----EGAGAGRPRLISYPPLREGSREASP----------EAEAEAEQSE
G3VRY3_BAD-02           -----EGAGAGRPRLISYPPLREGSREASP----------EAEAEAEQSE
G3VRY3_BAD-01           -----EGAGAGRPRLISYPPLREGSREASP----------EAEAEAEQSE
A0A7N4NUH6_BCL2L11      --------------------------------------------------
A0A7N4NUH6_BCL2L11      -----DRSPAPMSCDKSTQTPSPPCQAFNH----------YLSAMGKQDH
                                                                          

A0A7N4PJP2_BMF-01       SSLRLG--AEPPEEQWEHRAEVQIAR----KLQCIADQFHRLH---MQRH
A0A7N4NUH6_BCL2L11      ASMRQS--QSIPADM---RPEIWIAQ----ELRRIGDEFNASY---PRRA
A0A7N4NUH6_BCL2L11      ASMRQS--QSIPADM---RPEIWIAQ----ELRRIGDEFNASY---PRRG
G3VRY3_BAD-03           GEEERGLFRGRSSSA---PPILWAARHYGSELRRMSDEFHCTFKGLPRPK
G3VRY3_BAD-02           GEEERGLFRGRSSSA---PPILWAARHYGSELRRMSDEFHCTFKGLPRPK
G3VRY3_BAD-01           GEEERGLFRGRSSSA---PPILWAARHYGSELRRMSDEFHCTFKGLPRPK
A0A7N4NUH6_BCL2L11      ASMRQS--QSIPADM---RPEIWIAQ----ELRRIGDEFNASY---PRRN
A0A7N4NUH6_BCL2L11      ASMRQS--QSIPADM---RPEIWIAQ----ELRRIGDEFNASY---PRRN
                        ..   .     . .     . :. *.    :*. :.*:*:  .    .  

A0A7N4PJP2_BMF-01       Q-------QNQNHVWWQILLFLHNLALNREENRNGAGPR
A0A7N4NUH6_BCL2L11      V-------WHG---------------FKSFGIGVGSQL-
A0A7N4NUH6_BCL2L11      F-------LDNNYQAADDHHQMVILRLLHYIIRLVWRMQ
G3VRY3_BAD-03           SAGT----ASQMRRSHGWTRTFQSWFGRNLGKGSVGPSH
G3VRY3_BAD-02           SAGT----ASQMRRSHGWTRTFQSWFGRNLGKGSVGPSH
G3VRY3_BAD-01           SAGT----ASQMRRSHGWTRTFQSWFGRNLGKGSVGPSH
A0A7N4NUH6_BCL2L11      VIVTMWKFTERVLSIDKYIKVL-----------------
A0A7N4NUH6_BCL2L11      VIVTMWKFTERVLSIDKYIKVL-----------------
                                                               

© 1998-2022Legal notice