Dataset for protein Bmf of organism Salmo trutta

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bcl2dbpro|A0A673YQV3_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Salmo trutta GN=BMF (length=162 residues).
MDDEEDDVFEPDSHCWRTAFREIKYEDRGTQTPSPVLPLPNNMLPCGVAQEPRPLFYGNAGFRLHFPAQFERVGDQGPLG
ERGERGGMERLNQQPQQPARSIEICIGQKLQLIGDQFHQEHVQVYHRNQRNMRPLWRRLASALLTLLFEQEAIAGGERAG
WR
>gnl|bcl2dbpro|A0A674EF64_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Salmo trutta GN=BMF (length=161 residues).
MDDEEDDVFVPDSSHCWRTAFREIKYEDRGTQTPSPALALPNDMLPCGVAQEPRPLFYGNAGFRLHFPARFEQVGDQGPQ
EQHQGERGRMERLLQQPVQSMEVCIGQKLQLIGDQFYQEHLQLYHRNQRNMRPLWWRLASALFTLLFEQEAIAGRGRAGW
R
© 1998-2020Legal notice