Dataset for protein Bmf of organism Salmo trutta

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A673YQV3_BMF-01      MDDEEDDVFEPD-SHCWRTAFREIKYEDRGTQTPSPVLPLPNNMLPCGVA
A0A674EF64_BMF-01      MDDEEDDVFVPDSSHCWRTAFREIKYEDRGTQTPSPALALPNDMLPCGVA
                       ********* ** ***********************.*.***:*******

A0A673YQV3_BMF-01      QEPRPLFYGNAGFRLHFPAQFERVGDQGPLGE-RGERGGMERLNQQPQQP
A0A674EF64_BMF-01      QEPRPLFYGNAGFRLHFPARFEQVGDQGPQEQHQGERGRMERL---LQQP
                       *******************.**.******  : .**** ****    ***

A0A673YQV3_BMF-01      ARSIEICIGQKLQLIGDQFHQEHVQVYHRNQRNMRPLWRRLASALLTLLF
A0A674EF64_BMF-01      VQSMEVCIGQKLQLIGDQFYQEHLQLYHRNQRNMRPLWWRLASALFTLLF
                       ..*:*:*************:***:*:************.******:****

A0A673YQV3_BMF-01      EQEAIAGGERAGWR
A0A674EF64_BMF-01      EQEAIAGRGRAGWR
                       *******  *****

© 1998-2020Legal notice