Dataset for protein Bim of organism Salmo trutta

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bcl2dbpro|A0A673WET2_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Salmo trutta GN=BCL2L11 (length=214 residues).
MSDSSRQQNQSNGSTILIERGKYGELNPGGGAASGAEPTDNPQFSERDQQSRGGIMMPNSLLGFQSRSPLFRTLSRSSSG
YFSFDSDSIPSSPLLKDNKSTQTPSPSSQVMTHALQRMSQAQETNRDYDAWPNPLHPYRPRPPPTAGDMWPETLIGQELQ
RIGDEFNDLVIHRLAEGNGQVAQENLQQMHQEPAFLLWMGLLIGRLLQIILQRR
>gnl|bcl2dbpro|A0A673XGV4_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Salmo trutta GN=BCL2L11 (length=218 residues).
QNKIYKKRGYYCNLWVAIMDQGESGESHPGGGAASRAEPSDNPQSCEGDQQSLGGIMIPNSLLGFQSRSPVFRTLSRSSS
GYFSFDSDSIPSSPLLKDKSTQTPSPSSQVITHALQRMSRALETGRDYGKAHVWPNPLRPYRSRPPPTAGDMRPEILIGQ
ELQRIGDEFNNLIIHRRLAGRNGQVAQGNLQHMHQEPAFLLWMSLLIGRLLQIILRRR
© 1998-2020Legal notice