Dataset for protein Bim of organism Salmo trutta

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A673WET2_BCL2L11      MSDSSRQQN-QSNGSTILIERGKYGELNPGGGAASGAEPTDNPQFSERDQ
A0A673XGV4_BCL2L11      QNKIYKKRGYYCNLWVAIMDQGESGESHPGGGAASRAEPSDNPQSCEGDQ
                         ..  .:..  .*  . :::.*: ** :******* ***:**** .* **

A0A673WET2_BCL2L11      QSRGGIMMPNSLLGFQSRSPLFRTLSRSSSGYFSFDSDSIPSSPLLKDNK
A0A673XGV4_BCL2L11      QSLGGIMIPNSLLGFQSRSPVFRTLSRSSSGYFSFDSDSIPSSPLLKD-K
                        ** ****:************:*************************** *

A0A673WET2_BCL2L11      STQTPSPSSQVMTHALQRMSQAQETNRDY---DAWPNPLHPYRPRPPPTA
A0A673XGV4_BCL2L11      STQTPSPSSQVITHALQRMSRALETGRDYGKAHVWPNPLRPYRSRPPPTA
                        ***********:********.* **.***    .*****.***.******

A0A673WET2_BCL2L11      GDMWPETLIGQELQRIGDEFNDLVIH-RLAEGNGQVAQENLQQMHQEPAF
A0A673XGV4_BCL2L11      GDMRPEILIGQELQRIGDEFNNLIIHRRLAGRNGQVAQGNLQHMHQEPAF
                        ***.** **************:*:** ***  ****** ***:*******

A0A673WET2_BCL2L11      LLWMGLLIGRLLQIILQRR
A0A673XGV4_BCL2L11      LLWMSLLIGRLLQIILRRR
                        ****.***********.**

© 1998-2020Legal notice