Dataset for protein Bad of organism Salmo trutta

[Download (right click)] [Alignment] [Repertoires]

3 sequence(s)

>gnl|bcl2dbpro|A0A673ZHY7_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Salmo trutta GN=BAD (length=156 residues).
MDHTHDCVDDNPETMNEQDESDHSGTTHYPEFQLHYVSTRTSIRPRPGERVRLYSESQVCSQVGRREDTEFQDVMTPTEE
GGGDGAPFRSRSQSAPPTLWAAKKYGRQLRRMSDEFDTWLDKGEPKRGISPGGVKQEVSRGWFSFLWSPKKAEGRE
>gnl|bcl2dbpro|A0A674AVP9_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Salmo trutta GN=BAD (length=147 residues).
MDHTHDCVDECESDHSGTTHNSEFQLHVSTTMSNRPRPGERVRLYSESQVCSQVGKREDTEFQDVMTPTEEGGGDGASFR
GRSQSAPPALWAAKKYGCQLRRMSDEFDTWLDKGVPKRGIIPRGGKQKVSRGWFSFLWSPKEAEGRE
>gnl|bcl2dbpro|A0A674DKC6_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Salmo trutta GN=BAD (length=420 residues).
SLSSLSLPLLLSLSSLSLSSLSPSPLSPLLSLSSLLSRPLRLPLPLSLSASPSSSPLLCLSPSSLSCLSLSSLSSPLSPP
SPLSLSLPLLLPSPLSPLSSLSLPLLSLSSLSPSPLSLLSPLLLSSLSLCLSSFPSPLSPPLLSLSLSSPSPLSPPSPLS
LPLLSLSLSSLSPSPLSASPPFPLPLSLPLLSLFLCLFSLSLPLFSLSASPPVSLSLSSRLFPPFPLSISLPSLSTPLPL
HLTAFLFPLLTSSSSVDVSMAQMFTISDSESEPSEEVGETEKDQSSAGKGMTGGPIGHTLTVPEMRLAGEGRLRMNSESQ
AQELQGRGPGVEGVPTDGASFRGRSQSAPPALWAAKRYGRQLRRMSDEFDTWLDKGEMRRVKSAGAAKQMTKSPSWWAYL
FSHKETETEHTPTIPPRSSE
© 1998-2020Legal notice