Dataset for protein Bad of organism Salmo trutta

[Download (right click)] [Edit] [Sequences] [Repertoires]

3 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A674DKC6_BAD-01      SLSSLSLPLLLSLSSLSLSSLSPSPLSPLLSLSSLLSRPLRLPLPLSLSA
A0A673ZHY7_BAD-01      --------------------------------------------------
A0A674AVP9_BAD-01      --------------------------------------------------
                                                                         

A0A674DKC6_BAD-01      SPSSSPLLCLSPSSLSCLSLSSLSSPLSPPSPLSLSLPLLLPSPLSPLSS
A0A673ZHY7_BAD-01      --------------------------------------------------
A0A674AVP9_BAD-01      --------------------------------------------------
                                                                         

A0A674DKC6_BAD-01      LSLPLLSLSSLSPSPLSLLSPLLLSSLSLCLSSFPSPLSPPLLSLSLSSP
A0A673ZHY7_BAD-01      --------------------------------------------------
A0A674AVP9_BAD-01      --------------------------------------------------
                                                                         

A0A674DKC6_BAD-01      SPLSPPSPLSLPLLSLSLSSLSPSPLSASPPFPLPLSLPLLSLFLCLFSL
A0A673ZHY7_BAD-01      --------------------------------------------------
A0A674AVP9_BAD-01      --------------------------------------------------
                                                                         

A0A674DKC6_BAD-01      SLPLFSLSASPPVSLSLSSRLFPPFPLSISLPSLSTPLPLHLTAFLFPLL
A0A673ZHY7_BAD-01      --------------------------------------------------
A0A674AVP9_BAD-01      --------------------------------------------------
                                                                         

A0A674DKC6_BAD-01      TSSSSVDVSMAQMFTISDSESEPSEEVGETEKDQSSAGKGMTGGPIGHTL
A0A673ZHY7_BAD-01      ------------MDHTHDCVDDNPETMNEQDESDHSGTTHYPEFQLHYVS
A0A674AVP9_BAD-01      ------------MDHTHDCVDEC--------ESDHSGTTHNSEFQLH-VS
                                   *    *. .:         :.: *. .  .   :  . 

A0A674DKC6_BAD-01      TVPEMRLAGEGRLRMNSESQAQELQGR----------GPGVEGVPTDGAS
A0A673ZHY7_BAD-01      TRTSIRPRPGERVRLYSESQVCSQVGRREDTEFQDVMTPTEEG-GGDGAP
A0A674AVP9_BAD-01      TTMSNRPRPGERVRLYSESQVCSQVGKREDTEFQDVMTPTEEG-GGDGAS
                       *  . *     *:*: ****. .  *.           *  **   ***.

A0A674DKC6_BAD-01      FRGRSQSAPPALWAAKRYGRQLRRMSDEFDTWLDKGEMRRVKSAGAAKQM
A0A673ZHY7_BAD-01      FRSRSQSAPPTLWAAKKYGRQLRRMSDEFDTWLDKGEPKRGISPGGVKQE
A0A674AVP9_BAD-01      FRGRSQSAPPALWAAKKYGCQLRRMSDEFDTWLDKGVPKRGIIPRGGKQK
                       **.*******:*****.** ****************  .*   . . ** 

A0A674DKC6_BAD-01      TKSPSWWAYLFSHKETETEHTPTIPPRSSE
A0A673ZHY7_BAD-01      V-SRGWFSFLWSPKKAEGRE----------
A0A674AVP9_BAD-01      V-SRGWFSFLWSPKEAEGRE----------
                       . * .*:::*:* *::*             

© 1998-2020Legal notice