Dataset for protein Bad of organism Salmo salar

[Download (right click)] [Alignment] [Repertoires]

4 sequence(s)

>gnl|bcl2dbpro|A0A1S3L0Z2_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Salmo salar GN=BAD (length=147 residues).
MDYTHDCVDECESDHSGTTRNSEFQLHVSTTMSNRPRPGERVRLYSESQVCSQVGKREDTEFQDVMTPTEEGGGDGASFR
GRSQSAPPALWAAKKYGCQLRRMSDEFDTWLDKGVPKRGIIPRGGKQKVSRGWFSFLWSPKEAEGRE
>gnl|bcl2dbpro|A0A1S3N9Q3_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Salmo salar GN=BAD (length=158 residues).
MAQIFTISDSESEEVGETENDQSSAGKGMTGGPIGHALTVPEMRLAGEGRLRMNSESQAQELQGRGPGVEGMPTDGASFR
GRSQSAPPALWAAKRYGRQLRRMSDEFDTWLDKGEMRRVKSAGAAKQMTKSPSWWAYLFSHKETETEHTPTIPPRSSE
>gnl|bcl2dbpro|B5X1T1_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Salmo salar GN=BAD (length=156 residues).
MDHTHDCVDDNPETMNEHDESDHSGTTHYPEFQRHYVSTRTGIRPRPGGRVRLYSESQVCSQVGRRDNTEFQDVMTPTEE
GGGDGAPFRSRSQSAPPTLWAAKKYGRQLRRMSDEFDTWLDKGEPKRGISPGGVKQEVSRGWFSFLWSPKKAEGRE
>gnl|bcl2dbpro|B5XEF1_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Salmo salar GN=BAD (length=147 residues).
MDYTHDCVDECESDHSGTTRNSEFQLHVSTTMSNRPRPGERVRLYSESQVRSQVGKREDTEFQDVMTPTEEGGGDGASFR
GRSQSAPPALWAAKKYGCQLRRMSDEFDTWLDKGVPKRGIIPRGGKQKVSRGWFSFLWSPKEAEGRE
© 1998-2022Legal notice