Dataset for protein Bad of organism Salmo salar

[Download (right click)] [Edit] [Sequences] [Repertoires]

4 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


B5X1T1_BAD-01          -------MDHTHDCVDDNPETMNEHDESDHS--GTTHYPEFQRHYVSTRT
A0A1S3N9Q3_BAD-01      MAQIFTISDSESEEVGET--------ENDQSSAGKGMTGGPIGH-ALTVP
A0A1S3L0Z2_BAD-01      -------MDYTHDCVDEC--------ESDHS--GTTRNSEFQLH-VSTTM
B5XEF1_BAD-01          -------MDYTHDCVDEC--------ESDHS--GTTRNSEFQLH-VSTTM
                               *   : *.:         *.*:*  *.        * . *  

B5X1T1_BAD-01          GIRPRPGGRVRLYSESQVCSQVGRRDNTEFQDVMTPTEEGGGDGAPFRSR
A0A1S3N9Q3_BAD-01      EMRLAGEGRLRMNSESQAQELQGRGPGVEGMPT---------DGASFRGR
A0A1S3L0Z2_BAD-01      SNRPRPGERVRLYSESQVCSQVGKREDTEFQDVMTPTEEGGGDGASFRGR
B5XEF1_BAD-01          SNRPRPGERVRLYSESQVRSQVGKREDTEFQDVMTPTEEGGGDGASFRGR
                         *     *:*: ****. .  *.  ..*   .         ***.**.*

B5X1T1_BAD-01          SQSAPPTLWAAKKYGRQLRRMSDEFDTWLDKGEPKRGISPGGVKQEVSR-
A0A1S3N9Q3_BAD-01      SQSAPPALWAAKRYGRQLRRMSDEFDTWLDKGEMRR-VKSAGAAKQMTKS
A0A1S3L0Z2_BAD-01      SQSAPPALWAAKKYGCQLRRMSDEFDTWLDKGVPKRGIIPRGGKQKVSR-
B5XEF1_BAD-01          SQSAPPALWAAKKYGCQLRRMSDEFDTWLDKGVPKRGIIPRGGKQKVSR-
                       ******:*****.** ****************  .* : . *  ::::. 

B5X1T1_BAD-01          -GWFSFLWSPKKAEGRE----------
A0A1S3N9Q3_BAD-01      PSWWAYLFSHKETETEHTPTIPPRSSE
A0A1S3L0Z2_BAD-01      -GWFSFLWSPKEAEGRE----------
B5XEF1_BAD-01          -GWFSFLWSPKEAEGRE----------
                        .*:::*:* *::*             

© 1998-2022Legal notice