Dataset for protein classical BH3-containing proteins of organism Salarias fasciatus

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bcl2dbpro|A0A672HG10_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Salarias fasciatus GN=BMF (length=165 residues).
MDDEEDDVFEPDPRCWRTAFREIKCEDRGTQTPGPVLVPNNGMLPCGVAEEPRPLFYGNAGFRLHFPAHFELVGDHRVRR
RESEEQQNGMDQLPRQRPAAQSVEACIGQKLQLIGDQFHREHLQLYHRNQRNQGPLWWRLATTLLSLLFDRGVIAGGGGG
GAGRR
>gnl|bcl2dbpro|A0A672JQ68_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Salarias fasciatus GN=BAD (length=166 residues).
MAAKFSISDSESEPSEEVEEEETNETPADQRVRRRLDLSLNEFNLTATGRIRLNSESIASTVSRDEELQARAEEEVGTPT
EGAPFRGRSKSAPPALWAAKKYGQRLRRMSDEFDSLLDKGEMKKLRNPGQARQIHHSRSWWSYLFSHQETEGENNHHENH
SHDRTE
© 1998-2020Legal notice