Dataset for protein classical BH3-containing proteins of organism Salarias fasciatus

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A672HG10_BMF-01      -----------------MDDEEDDVFEPDPRCWRTAFREIKCEDRGTQTP
A0A672JQ68_BAD-01      MAAKFSISDSESEPSEEVEEEETNETPADQRVRRRL--DLSLNEFNLTAT
                                        :::** :   .* * .*    ::. :: .  :.

A0A672HG10_BMF-01      GPVLVPNNGMLPCGVAEEPRPLFYGNAGFRLHFPAHFELVGDHRVRRRES
A0A672JQ68_BAD-01      GRIRLNSESIAST-------------------------VSRDEELQARAE
                       * : : .:.: .                          :  *  :. * .

A0A672HG10_BMF-01      EEQQNGMDQLP-----RQRPAAQSVEACIGQKLQLIGDQFHREHLQLYHR
A0A672JQ68_BAD-01      EEVGTPTEGAPFRGRSKSAPPALWAAKKYGQRLRRMSDEFDSLLDKGEMK
                       **  .  :  *     .. *.*  .    **.*. :.*:*     :   .

A0A672HG10_BMF-01      NQRNQGPL--------WWRLATTLLSLLFDRGVIAGGGGGGAGRR-----
A0A672JQ68_BAD-01      KLRNPGQARQIHHSRSWW-------SYLFSHQETEGENNHHENHSHDRTE
                       : ** *          **       * **..    * ..   ..      

© 1998-2020Legal notice