Dataset for protein Bim of organism Saimiri boliviensis boliviensis

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bcl2dbpro|A0A2K6TRU4_BCL2L11-09 BCL2-like 11 protein OS=[Eukaryota] Saimiri boliviensis boliviensis GN=BCL2L11 (length=96 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMDEATGSSLA
LRREVQCPLEWLAKSS
>gnl|bcl2dbpro|A0A2K6TRU4_BCL2L11-08 BCL2-like 11 protein OS=[Eukaryota] Saimiri boliviensis boliviensis GN=BCL2L11 (length=135 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLF
IFVRRSSVLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMADWD
© 1998-2020Legal notice