Dataset for protein Bim of organism Saimiri boliviensis boliviensis

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2K6TRU4_BCL2L11      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQ---------
A0A2K6TRU4_BCL2L11      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGG
                        *****************************************         

A0A2K6TRU4_BCL2L11      --------------------------------------------------
A0A2K6TRU4_BCL2L11      EGDSCPHGSPQGPLAPPASPGPFATRSPLFIFVRRSSVLSRSSSGYFSFD
                                                                          

A0A2K6TRU4_BCL2L11      -DRSPAPMSCDKSTQTPSPPCQAFNHYLSAMDEATGSSLALRREVQCPLE
A0A2K6TRU4_BCL2L11      TDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMADWD---------------
                         ****************************** :                 

A0A2K6TRU4_BCL2L11      WLAKSS
A0A2K6TRU4_BCL2L11      ------
                              

© 1998-2020Legal notice