Dataset for protein Bmf of organism Rhinolophus ferrumequinum

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bcl2dbpro|A0A671DWL6_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Rhinolophus ferrumequinum GN=BMF (length=184 residues).
MEPPQCVEELEDDVFQPEDGDLGTQPGSLPSADLFAQSQLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQ
GVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAGLPLGEQPPEGQWQHRAEIQIARKLQCIADQFHRLHMQQHQQNRNRVW
WQILLFLHNLALNGDENRNGAGPR
>gnl|bcl2dbpro|A0A671DWL6_BMF-02 Bcl2 modifying factor protein OS=[Eukaryota] Rhinolophus ferrumequinum GN=BMF (length=193 residues).
MPYYALTGEMEPPQCVEELEDDVFQPEDGDLGTQPGSLPSADLFAQSQLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQ
TLSPASPSQGVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAGLPLGEQPPEGQWQHRAEIQIARKLQCIADQFHRLHMQQ
HQQNRNRVWWQILLFLHNLALNGDENRNGAGPR
© 1998-2020Legal notice