Dataset for protein Bmf of organism Rhinolophus ferrumequinum

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A671DWL6_BMF-01      ---------MEPPQCVEELEDDVFQPEDGDLGTQPGSLPSADLFAQSQLD
A0A671DWL6_BMF-02      MPYYALTGEMEPPQCVEELEDDVFQPEDGDLGTQPGSLPSADLFAQSQLD
                                *****************************************

A0A671DWL6_BMF-01      CPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEE
A0A671DWL6_BMF-02      CPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEE
                       **************************************************

A0A671DWL6_BMF-01      PQRLFYGNAGYRLPLPASFPAGLPLGEQPPEGQWQHRAEIQIARKLQCIA
A0A671DWL6_BMF-02      PQRLFYGNAGYRLPLPASFPAGLPLGEQPPEGQWQHRAEIQIARKLQCIA
                       **************************************************

A0A671DWL6_BMF-01      DQFHRLHMQQHQQNRNRVWWQILLFLHNLALNGDENRNGAGPR
A0A671DWL6_BMF-02      DQFHRLHMQQHQQNRNRVWWQILLFLHNLALNGDENRNGAGPR
                       *******************************************

© 1998-2020Legal notice