Dataset for protein Puma of organism Rhinolophus ferrumequinum

[Download (right click)] [Alignment] [Repertoires]

3 sequence(s)

>gnl|bcl2dbpro|A0A671F3X5_BBC3-01 BCL2 binding component 3 protein OS=[Eukaryota] Rhinolophus ferrumequinum GN=BBC3 (length=259 residues).
RVSAGAARACPCQVPRLPSGWVPHQICGPRERHGPSTPGGQLPGARRGPGPRRPAPLPTQPPGALGCVLRPLRARPARCP
RRPCPAASCLPLRPHSPAHRHLHPGGPPLAWGSPQPAPRPAPRRSSALTLTRGAAPGIAGAQRPGCPGGRPHPRSPGSPG
GGGAVGPRDRGPAAANGGRPRRTVRAAETRGAAATPPLALEGPVQPDHGTAALTQGPWSPRDGAQLGACTRTVDVRDLGG
RTLPPPDALASAGDIFCTM
>gnl|bcl2dbpro|A0A671F3X5_BBC3-03 BCL2 binding component 3 protein OS=[Eukaryota] Rhinolophus ferrumequinum GN=BBC3 (length=99 residues).
RVSAGAARACPCQVPRLPSGWVPHQICETRGAAATPPLALEGPVQPDHGTAALTQGPWSPRDGAQLGACTRTVDVRDLGG
RTLPPPDALASAGDIFCTM
>gnl|bcl2dbpro|A0A671F3X5_BBC3-02 BCL2 binding component 3 protein OS=[Eukaryota] Rhinolophus ferrumequinum GN=BBC3 (length=129 residues).
RVSAGAARACPCQVPRLPSGWVPHQICGPQPSLSPAEQHLESPVPSAPGALAGGPTHAAPGVRGEEEQWAREIGAQLRRM
ADDLDALYERRRQEEQQRHRPSPWRVLYNLIMGLLPLPRGRGAPEMEPN
© 1998-2020Legal notice