Dataset for protein Puma of organism Rhinolophus ferrumequinum

[Download (right click)] [Edit] [Sequences] [Repertoires]

3 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A671F3X5_BBC3-01      RVSAGAARACPCQVPRLPSGWVPHQICGPRERHGPSTPGGQLPGARRGPG
A0A671F3X5_BBC3-03      RVSAGAARACPCQVPRLPSGWVPHQICET---------------------
A0A671F3X5_BBC3-02      RVSAGAARACPCQVPRLPSGWVPHQICGP---------------------
                        *************************** .                     

A0A671F3X5_BBC3-01      PRRPAPLPTQPPGALGCVLRPLRARPARCPRRPCPAASCLPLRPHSPAHR
A0A671F3X5_BBC3-03      --------------------------------------------------
A0A671F3X5_BBC3-02      --------------------------------------------------
                                                                          

A0A671F3X5_BBC3-01      HLHPGGPPLAWGSPQPAPRPAPRRSSALTLTRGAAPGIAGAQRPGCPGGR
A0A671F3X5_BBC3-03      --------------------------------------------------
A0A671F3X5_BBC3-02      --------------------------------------------------
                                                                          

A0A671F3X5_BBC3-01      PHPRSPGSPGGGGAVGPRDRGPAAANGGRPRRTVRAAETRGAAATPPLAL
A0A671F3X5_BBC3-03      ---------------------------------------RGAAATPPLAL
A0A671F3X5_BBC3-02      ---------------------------------------QPSLSPAEQHL
                                                               . : :..   *

A0A671F3X5_BBC3-01      EGPVQPDHGTAALTQGP-------------WSPRDGAQLGACTRTVDVRD
A0A671F3X5_BBC3-03      EGPVQPDHGTAALTQGP-------------WSPRDGAQLGACTRTVDVRD
A0A671F3X5_BBC3-02      ESPVPSAPG--ALAGGPTHAAPGVRGEEEQWAREIGAQLRRMADDLDALY
                        *.** .  *  **: **             *:   ****   :  :*.  

A0A671F3X5_BBC3-01      LGGRTLPPPDALASAGDIFCTM-------------------
A0A671F3X5_BBC3-03      LGGRTLPPPDALASAGDIFCTM-------------------
A0A671F3X5_BBC3-02      ERRRQEEQQRHRPSPWRVLYNLIMGLLPLPRGRGAPEMEPN
                           *        .*.  :: .:                   

© 1998-2020Legal notice