Dataset for protein Noxa of organism Prolemur simus

[Download (right click)] [Alignment] [Repertoires]

3 sequence(s)

>gnl|bcl2dbpro|A0A8C8ZIH1_PMAIP1-01 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Prolemur simus GN=PMAIP1 (length=54 residues).
MPVKRARRNAQPNPTRPRTEIQEECALQLRRIGDKLRFQQKLLNLIAKLLRSGT
>gnl|bcl2dbpro|A0A8C9AR60_PMAIP1-01 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Prolemur simus GN=PMAIP1 (length=61 residues).
MGVLILAAYSGWNIVNVNFHVLLSFSEIQEECALQLRRIGDKLHFQQKLLNLIAKLLRSGT
>gnl|bcl2dbpro|A0A8C9DED2_PMAIP1-01 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Prolemur simus GN=PMAIP1 (length=54 residues).
MPMKRARRNAQPNPMRPRTEIQEECALQLRRIGDKLHFQQKLLNLIAKLLRSGT
© 1998-2022Legal notice