Dataset for protein Noxa of organism Prolemur simus

[Download (right click)] [Edit] [Sequences] [Repertoires]

3 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8C9AR60_PMAIP1-      MGVLILAAYSGWNIVNVNFHVLLSFSEIQEECALQLRRIGDKLHFQQKLL
A0A8C8ZIH1_PMAIP1-      -------MPVKRARRNAQPNPTRPRTEIQEECALQLRRIGDKLRFQQKLL
A0A8C9DED2_PMAIP1-      -------MPMKRARRNAQPNPMRPRTEIQEECALQLRRIGDKLHFQQKLL
                                   .   *.: :   . :*****************.******

A0A8C9AR60_PMAIP1-      NLIAKLLRSGT
A0A8C8ZIH1_PMAIP1-      NLIAKLLRSGT
A0A8C9DED2_PMAIP1-      NLIAKLLRSGT
                        ***********

© 1998-2022Legal notice