Dataset for protein classical BH3-containing proteins of organism Prolemur simus

[Download (right click)] [Alignment] [Repertoires]

13 sequence(s)

>gnl|bcl2dbpro|A0A8C8YJE2_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Prolemur simus GN=BAD (length=167 residues).
MFQIPEFEPSEQEDSSSTDRGLGPSPSGDRPPGPGKHPCSAPSFLRDASHQQGQPSSSSHHGGAGSVETRSRHSSYPAGS
EEDEGMEEEPSRFRGRSRSAPPNLWAAQRYGRELRRMSDEFEDSFKGLPRPKSAGTATQIRQSSSWTRVIQSWWDRNVGR
GGSAPSQ
>gnl|bcl2dbpro|A0A8C8ZAV1_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Prolemur simus GN=BMF (length=184 residues).
MEPSQCVEELEDDVFQPEDGESGTQPGSVLSADLFAQSQLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQ
GVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAGLPLGEQPAEGQWQHRAEVQIARKLQRIADQFHRLHVQQHQQNQNRVW
WQILLFLHNLALNGEENRNGAGPR
>gnl|bcl2dbpro|A0A8C8ZIH1_PMAIP1-01 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Prolemur simus GN=PMAIP1 (length=54 residues).
MPVKRARRNAQPNPTRPRTEIQEECALQLRRIGDKLRFQQKLLNLIAKLLRSGT
>gnl|bcl2dbpro|A0A8C8ZKT5_BIK-01 BCL2-interacting killer protein OS=[Eukaryota] Prolemur simus GN=BIK (length=148 residues).
MSEVRPISTDLFMETFPFRHLLDPLILEVVSVMDAEDPDPLGCLEGSDQVALRLAYIGDAMNLRVSSPRLARLPRMTMRR
LGLSCDQPVRWGVLGSLSDGFTNLRENVARLWRSLSPRPSVCPVPAWEQVLVLLLVLLLGRGLHLLLK
>gnl|bcl2dbpro|A0A8C8ZU60_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Prolemur simus GN=BCL2L11 (length=200 residues).
MAKQPSDVGSECDREGGRLQPVERPPQLRPGAPTSLQTEPQGNPEGSREGEGDRCPHGSPQGPLAPPASPGPFATRSPLF
IFVRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQFQAEPADMRPEIWIAQELRRIGDE
FNAYYPRRVFLNNYQEAEDLPQMVILRLLRYLVRLVWGRH
>gnl|bcl2dbpro|A0A8C8ZU60_BCL2L11-03 BCL2-like 11 protein OS=[Eukaryota] Prolemur simus GN=BCL2L11 (length=171 residues).
MAKQPSDVGSECDREGGRLQPVERPPQLRPGAPTSLQTEPQGNPEGSREGEGDRCPHGSPQGPLAPPASPGPFATRSPLF
IFVRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQFQAEPADMRPEIWIAQELRRIGDE
FNAYYPRRLEK
>gnl|bcl2dbpro|A0A8C8ZU60_BCL2L11-04 BCL2-like 11 protein OS=[Eukaryota] Prolemur simus GN=BCL2L11 (length=87 residues).
MAKQPSDVGSECDREGGRLQPVERPPQLRPGAPTSLQTEPQASMRQFQAEPADMRPEIWIAQELRRIGDEFNAYYPRRLA
KPLVPPI
>gnl|bcl2dbpro|A0A8C8ZU60_BCL2L11-02 BCL2-like 11 protein OS=[Eukaryota] Prolemur simus GN=BCL2L11 (length=140 residues).
MAKQPSDVGSECDREGGRLQPVERPPQLRPGAPTSLQTEPQDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQFQAE
PADMRPEIWIAQELRRIGDEFNAYYPRRVFLNNYQEAEDLPQMVILRLLRYLVRLVWGRH
>gnl|bcl2dbpro|A0A8C9AIW5_BBC3-02 BCL2 binding component 3 protein OS=[Eukaryota] Prolemur simus GN=BBC3 (length=193 residues).
MARARQEGSSPEPVEGLARDGPRPFPLGRLVPSAVSCGLCEPGLPAAPAAPALLPAAYLCAPTAPPAVTAALGGPRWPGG
PRSRPRGPRPDGPQPSLSLAEQHLESPVPSAPGALAGGPTQAAPGVRGEEEQWAREIGAQLRRMADDLNAQYERRRQEEQ
QRHRPSPWRVLYNLIMGLLPLPRGHRAPEMEPN
>gnl|bcl2dbpro|A0A8C9AIW5_BBC3-01 BCL2 binding component 3 protein OS=[Eukaryota] Prolemur simus GN=BBC3 (length=130 residues).
MKFGAGSARACPHVPGASFSRWVPGHIRGPQPSLSLAEQHLESPVPSAPGALAGGPTQAAPGVRGEEEQWAREIGAQLRR
MADDLNAQYERRRQEEQQRHRPSPWRVLYNLIMGLLPLPRGHRAPEMEPN
>gnl|bcl2dbpro|A0A8C9AQA8_HRK-01 Harakiri, BCL2 interacting protein protein OS=[Eukaryota] Prolemur simus GN=HRK (length=91 residues).
MCPCPLHRGRGPPAVCACSAGRLGLRASAAQLTAARLKALGDELHERTMRRRRARSRRAPAPRALPTYWPWLCAAAQVAA
LAAWLLGRRNL
>gnl|bcl2dbpro|A0A8C9AR60_PMAIP1-01 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Prolemur simus GN=PMAIP1 (length=61 residues).
MGVLILAAYSGWNIVNVNFHVLLSFSEIQEECALQLRRIGDKLHFQQKLLNLIAKLLRSGT
>gnl|bcl2dbpro|A0A8C9DED2_PMAIP1-01 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Prolemur simus GN=PMAIP1 (length=54 residues).
MPMKRARRNAQPNPMRPRTEIQEECALQLRRIGDKLHFQQKLLNLIAKLLRSGT
© 1998-2022Legal notice