Dataset for protein classical BH3-containing proteins of organism Prolemur simus

[Download (right click)] [Edit] [Sequences] [Repertoires]

13 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8C9AR60_PMAIP1-      --------------------------------------------------
A0A8C8ZIH1_PMAIP1-      --------------------------------------------------
A0A8C9DED2_PMAIP1-      --------------------------------------------------
A0A8C9AIW5_BBC3-01      --------------------------------------------------
A0A8C9AIW5_BBC3-02      -------MARARQEGSSPEPVEGLAR----------------DGPRPFPL
A0A8C9AQA8_HRK-01       ------------------------------------------MCPCPL--
A0A8C8ZAV1_BMF-01       MEPSQCVEELEDDVFQPEDGESGTQPGSVLSADLFAQSQLDCPLSRLQLF
A0A8C8ZKT5_BIK-01       -------------------------M----------------SEVRPIST
A0A8C8YJE2_BAD-01       MFQIPEFEPSEQEDSSSTDRGLGPSP----------------SGDRPPGP
A0A8C8ZU60_BCL2L11      ------MAKQPSDVGSECDREGGRLQ----------------PVERPP--
A0A8C8ZU60_BCL2L11      ------MAKQPSDVGSECDREGGRLQ----------------PVERPP--
A0A8C8ZU60_BCL2L11      ------MAKQPSDVGSECDREGGRLQ----------------PVERPP--
A0A8C8ZU60_BCL2L11      ------MAKQPSDVGSECDREGGRLQ----------------PVERPP--
                                                                          

A0A8C9AR60_PMAIP1-      --------------------------------------------------
A0A8C8ZIH1_PMAIP1-      --------------------------------------------------
A0A8C9DED2_PMAIP1-      --------------------------------------------------
A0A8C9AIW5_BBC3-01      MKFGAGSARACPHVPG----------------------------------
A0A8C9AIW5_BBC3-02      GRLVPSAVSCGLCEPG------------------------LPAAPAAPAL
A0A8C9AQA8_HRK-01       --------------------------------------------------
A0A8C8ZAV1_BMF-01       PLTHCCGPGLRPTSQE----------------------------------
A0A8C8ZKT5_BIK-01       DLFMETFPFRHLLDPL----------------------------------
A0A8C8YJE2_BAD-01       GKHPCSAPSFLRDASH----------------------------------
A0A8C8ZU60_BCL2L11      -QLRPGAPTSLQTEPQ----------------------------------
A0A8C8ZU60_BCL2L11      -QLRPGAPTSLQTEPQ----------------------------------
A0A8C8ZU60_BCL2L11      -QLRPGAPTSLQTEPQGNPEGSREGEGDRCPHGSPQGPLAPPASPGPFAT
A0A8C8ZU60_BCL2L11      -QLRPGAPTSLQTEPQGNPEGSREGEGDRCPHGSPQGPLAPPASPGPFAT
                                                                          

A0A8C9AR60_PMAIP1-      ---------------------MGVLILAAYSGWNIVNVNFHVLLSFSEIQ
A0A8C8ZIH1_PMAIP1-      ----------------------------MPVKRARRNAQPNPTRPRTEIQ
A0A8C9DED2_PMAIP1-      ----------------------------MPMKRARRNAQPNPMRPRTEIQ
A0A8C9AIW5_BBC3-01      --------------------------ASFSRWVPGHIRGPQPSLSLAEQH
A0A8C9AIW5_BBC3-02      LPAAYLCAPTAPPAVTAALGGPRWPGGPRSRPRGPRPDGPQPSLSLAEQH
A0A8C9AQA8_HRK-01       ------------------------------------HRGRGPPAVCACSA
A0A8C8ZAV1_BMF-01       --------------------------DKATQTLSPASPSQGVMLPCGVTE
A0A8C8ZKT5_BIK-01       -----------------ILEVVSVMDAEDPDPLGCLEGSDQVALRLAYIG
A0A8C8YJE2_BAD-01       --------------------------QQGQPSSSSHHGGAGSVETRSRHS
A0A8C8ZU60_BCL2L11      --------------------------------------------------
A0A8C8ZU60_BCL2L11      --------------------------DRSPAPMSCDKSTQTPSPPCQAFN
A0A8C8ZU60_BCL2L11      RSPLFIFVRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFN
A0A8C8ZU60_BCL2L11      RSPLFIFVRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFN
                                                                          

A0A8C9AR60_PMAIP1-      EECAL--------------------------------------------Q
A0A8C8ZIH1_PMAIP1-      EECAL--------------------------------------------Q
A0A8C9DED2_PMAIP1-      EECAL--------------------------------------------Q
A0A8C9AIW5_BBC3-01      LESPVPSAPGALA---------GGPTQAAPGVRGEEEQWAREIGA----Q
A0A8C9AIW5_BBC3-02      LESPVPSAPGALA---------GGPTQAAPGVRGEEEQWAREIGA----Q
A0A8C9AQA8_HRK-01       GRLGLRASAAQLT---------AA-------------------------R
A0A8C8ZAV1_BMF-01       EPQRLFYGNAGYRLPLPASFPAGLPLGEQPAEGQWQHRAEVQIAR----K
A0A8C8ZKT5_BIK-01       DAMNLRVSSPRLA---------RLPRMTMRRLGLSCDQPVRWG------V
A0A8C8YJE2_BAD-01       SYPAGSEEDEGME---------EEP--SRFRGRSRSAPPNLWAAQRYGRE
A0A8C8ZU60_BCL2L11      ------ASMRQFQ---------AEP--ADMR-------PEIWIAQ----E
A0A8C8ZU60_BCL2L11      HYLSAMASMRQFQ---------AEP--ADMR-------PEIWIAQ----E
A0A8C8ZU60_BCL2L11      HYLSAMASMRQFQ---------AEP--ADMR-------PEIWIAQ----E
A0A8C8ZU60_BCL2L11      HYLSAMASMRQFQ---------AEP--ADMR-------PEIWIAQ----E
                                                                          

A0A8C9AR60_PMAIP1-      LRRIGDKLHFQ-------------------------------QKLLNLIA
A0A8C8ZIH1_PMAIP1-      LRRIGDKLRFQ-------------------------------QKLLNLIA
A0A8C9DED2_PMAIP1-      LRRIGDKLHFQ-------------------------------QKLLNLIA
A0A8C9AIW5_BBC3-01      LRRMADDLNAQYERRRQEEQQRHRPSP--------------WRVLYNLIM
A0A8C9AIW5_BBC3-02      LRRMADDLNAQYERRRQEEQQRHRPSP--------------WRVLYNLIM
A0A8C9AQA8_HRK-01       LKALGDELHERTMRRRRARSRRAPAPRALPTYWPWLCAAAQVAALAAWLL
A0A8C8ZAV1_BMF-01       LQRIADQFHRLHVQQHQQNQNR------------------VWWQILLFLH
A0A8C8ZKT5_BIK-01       LGSLSDGFTNL--RENVARLWRSLSPR------PSVCPVPAWEQVLVLLL
A0A8C8YJE2_BAD-01       LRRMSDEFEDSFKG---LPRPKSAGTA------TQIRQSSSWTRVIQSWW
A0A8C8ZU60_BCL2L11      LRRIGDEFNAYYPRRLAKPLVPPI--------------------------
A0A8C8ZU60_BCL2L11      LRRIGDEFNAYYPRRVFLNNYQEAEDL------PQMVILRLLRYLVRLVW
A0A8C8ZU60_BCL2L11      LRRIGDEFNAYYPRRVFLNNYQEAEDL------PQMVILRLLRYLVRLVW
A0A8C8ZU60_BCL2L11      LRRIGDEFNAYYPRRLEK--------------------------------
                        *  :.* :                                          

A0A8C9AR60_PMAIP1-      KLLRSGT----------
A0A8C8ZIH1_PMAIP1-      KLLRSGT----------
A0A8C9DED2_PMAIP1-      KLLRSGT----------
A0A8C9AIW5_BBC3-01      GLLPLPRGHRAPEMEPN
A0A8C9AIW5_BBC3-02      GLLPLPRGHRAPEMEPN
A0A8C9AQA8_HRK-01       GRRNL------------
A0A8C8ZAV1_BMF-01       NLALNGEENRNGAGPR-
A0A8C8ZKT5_BIK-01       VLLLGRGLHLLLK----
A0A8C8YJE2_BAD-01       DRNVGRGGSAPSQ----
A0A8C8ZU60_BCL2L11      -----------------
A0A8C8ZU60_BCL2L11      GRH--------------
A0A8C8ZU60_BCL2L11      GRH--------------
A0A8C8ZU60_BCL2L11      -----------------
                                         

© 1998-2022Legal notice