Dataset for protein Bim of organism Prolemur simus

[Download (right click)] [Alignment] [Repertoires]

4 sequence(s)

>gnl|bcl2dbpro|A0A8C8ZU60_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Prolemur simus GN=BCL2L11 (length=200 residues).
MAKQPSDVGSECDREGGRLQPVERPPQLRPGAPTSLQTEPQGNPEGSREGEGDRCPHGSPQGPLAPPASPGPFATRSPLF
IFVRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQFQAEPADMRPEIWIAQELRRIGDE
FNAYYPRRVFLNNYQEAEDLPQMVILRLLRYLVRLVWGRH
>gnl|bcl2dbpro|A0A8C8ZU60_BCL2L11-03 BCL2-like 11 protein OS=[Eukaryota] Prolemur simus GN=BCL2L11 (length=171 residues).
MAKQPSDVGSECDREGGRLQPVERPPQLRPGAPTSLQTEPQGNPEGSREGEGDRCPHGSPQGPLAPPASPGPFATRSPLF
IFVRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQFQAEPADMRPEIWIAQELRRIGDE
FNAYYPRRLEK
>gnl|bcl2dbpro|A0A8C8ZU60_BCL2L11-04 BCL2-like 11 protein OS=[Eukaryota] Prolemur simus GN=BCL2L11 (length=87 residues).
MAKQPSDVGSECDREGGRLQPVERPPQLRPGAPTSLQTEPQASMRQFQAEPADMRPEIWIAQELRRIGDEFNAYYPRRLA
KPLVPPI
>gnl|bcl2dbpro|A0A8C8ZU60_BCL2L11-02 BCL2-like 11 protein OS=[Eukaryota] Prolemur simus GN=BCL2L11 (length=140 residues).
MAKQPSDVGSECDREGGRLQPVERPPQLRPGAPTSLQTEPQDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQFQAE
PADMRPEIWIAQELRRIGDEFNAYYPRRVFLNNYQEAEDLPQMVILRLLRYLVRLVWGRH
© 1998-2022Legal notice