Dataset for protein Bim of organism Prolemur simus

[Download (right click)] [Edit] [Sequences] [Repertoires]

4 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8C8ZU60_BCL2L11      MAKQPSDVGSECDREGGRLQPVERPPQLRPGAPTSLQTEPQ---------
A0A8C8ZU60_BCL2L11      MAKQPSDVGSECDREGGRLQPVERPPQLRPGAPTSLQTEPQ---------
A0A8C8ZU60_BCL2L11      MAKQPSDVGSECDREGGRLQPVERPPQLRPGAPTSLQTEPQGNPEGSREG
A0A8C8ZU60_BCL2L11      MAKQPSDVGSECDREGGRLQPVERPPQLRPGAPTSLQTEPQGNPEGSREG
                        *****************************************         

A0A8C8ZU60_BCL2L11      --------------------------------------------------
A0A8C8ZU60_BCL2L11      --------------------------------------------------
A0A8C8ZU60_BCL2L11      EGDRCPHGSPQGPLAPPASPGPFATRSPLFIFVRRSSLLSRSSSGYFSFD
A0A8C8ZU60_BCL2L11      EGDRCPHGSPQGPLAPPASPGPFATRSPLFIFVRRSSLLSRSSSGYFSFD
                                                                          

A0A8C8ZU60_BCL2L11      -------------------------------ASMRQFQAEPADMRPEIWI
A0A8C8ZU60_BCL2L11      -DRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQFQAEPADMRPEIWI
A0A8C8ZU60_BCL2L11      TDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQFQAEPADMRPEIWI
A0A8C8ZU60_BCL2L11      TDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQFQAEPADMRPEIWI
                                                       *******************

A0A8C8ZU60_BCL2L11      AQELRRIGDEFNAYYPRRLAKPLVPPI-----------------------
A0A8C8ZU60_BCL2L11      AQELRRIGDEFNAYYPRRVFLNNYQEAEDLPQMVILRLLRYLVRLVWGRH
A0A8C8ZU60_BCL2L11      AQELRRIGDEFNAYYPRRVFLNNYQEAEDLPQMVILRLLRYLVRLVWGRH
A0A8C8ZU60_BCL2L11      AQELRRIGDEFNAYYPRRLEK-----------------------------
                        ******************:                               

© 1998-2022Legal notice