Dataset for protein Noxa of organism Piliocolobus tephrosceles

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bcl2dbpro|A0A8C9H6M4_PMAIP1-02 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Piliocolobus tephrosceles GN=PMAIP1 (length=139 residues).
MPGKKARKNAQPSPARAQAGAGTAGTARDQAGFGIGMQLHFTRGKNLLSSSPLALSSSPLALPRGHEEQVQVARSRVCYS
TQEIWRQTEFPAETSESDSQTLLLRNLTESKTCIRGLQKRIFLRRCTFHQFEARLHCNW
>gnl|bcl2dbpro|A0A8C9H6M4_PMAIP1-01 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Piliocolobus tephrosceles GN=PMAIP1 (length=132 residues).
HRGSSHWTKAWSLALGPHSFPGTHRVYLVALRVRVVGPGTPARGSVGVQLASCRRPTRSSWRPRFPGSVAEWAAALAEMP
GKKARKNAQPSPARAQAELEVECATQLRRFGDKLNFRQKLLNLIAKLFCSGT
© 1998-2022Legal notice