Dataset for protein Noxa of organism Piliocolobus tephrosceles

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8C9H6M4_PMAIP1-      MPGKKARKNAQPSPARAQAGAGTAGTARDQAGFGIGMQLHFTRGKNLLSS
A0A8C9H6M4_PMAIP1-      ----------------------HRGSSHWTKAWSLALGPHSFPGTHRVYL
                                                *::.   .:.:.:  *   *.: :  

A0A8C9H6M4_PMAIP1-      SPLALSSSPLALPRGHEEQVQVARSRVCYSTQEIWRQ-------------
A0A8C9H6M4_PMAIP1-      VALRVRVVGPGTPARGSVGVQLASCR--RPTRSSWRPRFPGSVAEWAAAL
                         .* :     . *   .  **:* .*   .*.. **              

A0A8C9H6M4_PMAIP1-      TEFPAETSESDSQTLLLRNLT----ESKTCIRGLQKRIFLRRCTFHQFEA
A0A8C9H6M4_PMAIP1-      AEMPGKKARKNAQPSPARAQAELEVECATQLRRFGDKLNFRQ-KLLNLIA
                        :*:*.:.: .::*.   *  :    *. * :* : ..: :*. .: :: *

A0A8C9H6M4_PMAIP1-      RLHCNW-
A0A8C9H6M4_PMAIP1-      KLFCSGT
                        .*.*.  

© 1998-2022Legal notice