Dataset for protein Bad of organism Piliocolobus tephrosceles

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bcl2dbpro|A0A8C9HAT1_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Piliocolobus tephrosceles GN=BAD (length=167 residues).
MFQIPEFEPSEQEDSSSAERGLGPSPVGDRPSDSGKYHRQAPGLLWDASHQQEQPTSSSHHGGAGAVETRSRHSSYPAGT
EEDEGMEEEPSPFRGRSRSAPPNLWAAQRYGRELRRMSDEFVDSFKGLPRPKSAGTATQMRQSSSWTRVFQSWWDRNLGR
GSSAPSQ
>gnl|bcl2dbpro|A0A8C9HAT1_BAD-02 BCL2-associated agonist of cell death protein OS=[Eukaryota] Piliocolobus tephrosceles GN=BAD (length=162 residues).
MFQIPEFEPSEQEDSSSAERGLGPSPVGDRPSDSGKYHRQAPGLLWDASHQQEQPTSSSHHGGRAWYSPSESEDSENPSA
RMLAEASAGMSASATDSEAQHAENVKLEALGLWRPEVATAPTPRGRRRTKGWRRSPAPFGAARAPRPLTSGQHSDMAASS
GG
© 1998-2022Legal notice