Dataset for protein Bad of organism Piliocolobus tephrosceles

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8C9HAT1_BAD-01      MFQIPEFEPSEQEDSSSAERGLGPSPVGDRPSDSGKYHRQAPGLLWDASH
A0A8C9HAT1_BAD-02      MFQIPEFEPSEQEDSSSAERGLGPSPVGDRPSDSGKYHRQAPGLLWDASH
                       **************************************************

A0A8C9HAT1_BAD-01      QQEQPTSSSHHGG--------AGAVETRSRHSSYPAGTEEDEGMEEEPSP
A0A8C9HAT1_BAD-02      QQEQPTSSSHHGGRAWYSPSESEDSENPSARMLAEASAGMSASATDSEAQ
                       *************        :   *. * .    *.:  . .  :. : 

A0A8C9HAT1_BAD-01      FRGRSRSAPPNLW----------AAQRYGRELRRMSDEFVDSFKGLPRPK
A0A8C9HAT1_BAD-02      HAENVKLEALGLWRPEVATAPTPRGRRRTKGWRRSPAPF--GAARAPRPL
                       .  . .  . .**           ..*  .  ** .  *  .    *** 

A0A8C9HAT1_BAD-01      SAGTATQMRQSSSWTRVFQSWWDRNLGRGSSAPSQ
A0A8C9HAT1_BAD-02      TSGQHSDMAASSGG---------------------
                       ::*  ::*  **.                      

© 1998-2022Legal notice