Dataset for protein classical BH3-containing proteins of organism Phasianus colchicus

[Download (right click)] [Alignment] [Repertoires]

4 sequence(s)

>gnl|bcl2dbpro|A0A669PL85_BMF-02 Bcl2 modifying factor protein OS=[Eukaryota] Phasianus colchicus GN=BMF (length=194 residues).
MDRPSYLEEDYSSLDGLDDDVFHSDDFGLAGQPGEMTATGIFTQNQSYSCLLGRFQLFPLTHCCGPGVRQPEQQDKATQT
LSPSSSSQDVMLPCGVTEEPRRLFYGNAGYRLHVPPVGFALDPNLQEEPQEGQREARTEVQIARKLQCIADQFHRLHIQR
VGCFLRGRWGISYPRVVLQKTGSRLQLSNGLGQP
>gnl|bcl2dbpro|A0A669PL85_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Phasianus colchicus GN=BMF (length=193 residues).
MDRPSYLEEDYSSLDGLDDDVFHSDDFGLAGQPGEMTATGIFTQNQSYSCLLGRFQLFPLTHCCGPGVRQPEQQDKATQT
LSPSSSSQDVMLPCGVTEEPRRLFYGNAGYRLHVPPVGFALDPNLQEEPQEGQREARTEVQIARKLQCIADQFHRLHIQR
HQQNRNQVWWQLFLFLHNLALNVEANRNRTGQR
>gnl|bcl2dbpro|A0A669QIC6_PMAIP1-01 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Phasianus colchicus GN=PMAIP1 (length=114 residues).
MPGRTIRKPAPPAAPAGRERRREAGLNFFTGVDTGKKQAFPFFFSFFFSTVFFPSPISLSGKDLVRIKSPSPCACFAERD
AVAECALELRRIGDKADLRQKVLNLIAKLFCPKT
>gnl|bcl2dbpro|A0A669QMB4_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Phasianus colchicus GN=BCL2L11 (length=175 residues).
MAKQPPEAKAPRDRRAGRLPPGEGPGPAVPLRPGAPAALPGAARPASPGSPGPFAIRSPLFFFVRRSPLLPRSSSGYFSF
EAERSPAPMSCDKATQTPSPPCQAVSHYLSAMASRWRSHSLAEEIQPEIWIAQELRRIGDEFNASYCPRRVIFLFLLSIS
LPTKAPPVSGLAVNW
© 1998-2020Legal notice