Dataset for protein classical BH3-containing proteins of organism Phasianus colchicus

[Download (right click)] [Edit] [Sequences] [Repertoires]

4 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A669QIC6_PMAIP1-      MPGRTIRKPAPPAAPAGRERRREAGLNFFTGVDT----------------
A0A669QMB4_BCL2L11      ---MAKQPPEAKAPRDRRAGRLPPGEGPGPAVPLRPGAPAALPGAARPAS
A0A669PL85_BMF-02       ---------------MDRPSYLEEDYSSLDGLDDDVFHSDDFGLAGQPGE
A0A669PL85_BMF-01       ---------------MDRPSYLEEDYSSLDGLDDDVFHSDDFGLAGQPGE
                                         *      . .   .:                  

A0A669QIC6_PMAIP1-      -----------------GKKQAFPFFFSFFFSTVFFPSPISLSGKDLVRI
A0A669QMB4_BCL2L11      PGSPGPFAIRSPLFFFVRRSPLLPRSSSGYFSFEAERSPAPMSCDKATQT
A0A669PL85_BMF-02       MTATGIFTQNQSYSCLLGRFQLFPLTHCC-----GPGVRQPEQQDKATQT
A0A669PL85_BMF-01       MTATGIFTQNQSYSCLLGRFQLFPLTHCC-----GPGVRQPEQQDKATQT
                                          .   :*   .            . . .. .. 

A0A669QIC6_PMAIP1-      KSPS--------PCACFAE-------------------------------
A0A669QMB4_BCL2L11      PSP---------PCQAVSH----YLSAMASRWRSHSLAEEIQP-------
A0A669PL85_BMF-02       LSPSSSSQDVMLPCGVTEEPRRLFYGNAGYRLHVPPVGFALDPNLQEEPQ
A0A669PL85_BMF-01       LSPSSSSQDVMLPCGVTEEPRRLFYGNAGYRLHVPPVGFALDPNLQEEPQ
                         **         **                                    

A0A669QIC6_PMAIP1-      -----RDAVAECALELRRIGDKADLRQKVLNLIAKLFCPKT---------
A0A669QMB4_BCL2L11      --------EIWIAQELRRIGDE----------FNASYCPRRVIF------
A0A669PL85_BMF-02       EGQREARTEVQIARKLQCIADQ----------FHRLHIQRVGCFLRGRWG
A0A669PL85_BMF-01       EGQREARTEVQIARKLQCIADQ----------FHRLHIQRHQQNRNQVWW
                                    * :*. *.*:          :   .  .          

A0A669QIC6_PMAIP1-      ----------------------------
A0A669QMB4_BCL2L11      -----LFLLSISLPTKAP-PVSGLAVNW
A0A669PL85_BMF-02       ISYPRVVLQKTGSRLQLS-NGLGQP---
A0A669PL85_BMF-01       QLF--LFLHNLALNVEANRNRTGQR---
                                                    

© 1998-2020Legal notice