Dataset for protein Bim of organism Peromyscus maniculatus bairdii

[Download (right click)] [Alignment] [Repertoires]

3 sequence(s)

>gnl|bcl2dbpro|A0A6I9LW27_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Peromyscus maniculatus bairdii GN=BCL2L11 (length=193 residues).
MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTEPQGNPDGGGEGDRCPHGSPQGPLAPPASPGPFATRSPLFIF
VRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASIRQSQEEPADVRPEIRIAQELRRIGDEFN
ESYTRRAEDHPHHPQMVILQLLRFFIRLVWRRH
>gnl|bcl2dbpro|A0A6I9LW27_BCL2L11-02 BCL2-like 11 protein OS=[Eukaryota] Peromyscus maniculatus bairdii GN=BCL2L11 (length=135 residues).
MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTEPQDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASIRQSQEE
PADVRPEIRIAQELRRIGDEFNESYTRRAEDHPHHPQMVILQLLRFFIRLVWRRH
>gnl|bcl2dbpro|A0A6I9LW27_BCL2L11-03 BCL2-like 11 protein OS=[Eukaryota] Peromyscus maniculatus bairdii GN=BCL2L11 (length=91 residues).
MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTEPQDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMDLCETLKPR
EQIHGDAQKNW
© 1998-2022Legal notice