Dataset for protein Bim of organism Peromyscus maniculatus bairdii

[Download (right click)] [Edit] [Sequences] [Repertoires]

3 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A6I9LW27_BCL2L11      MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTEPQ---------
A0A6I9LW27_BCL2L11      MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTEPQGNPDGGGEG
A0A6I9LW27_BCL2L11      MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTEPQ---------
                        *****************************************         

A0A6I9LW27_BCL2L11      -------------------------------------------------D
A0A6I9LW27_BCL2L11      DRCPHGSPQGPLAPPASPGPFATRSPLFIFVRRSSLLSRSSSGYFSFDTD
A0A6I9LW27_BCL2L11      -------------------------------------------------D
                                                                         *

A0A6I9LW27_BCL2L11      RSPAPMSCDKSTQTPSPPCQAFNHYLSAM-------DLCETLKPREQIHG
A0A6I9LW27_BCL2L11      RSPAPMSCDKSTQTPSPPCQAFNHYLSAMASIRQSQEEPADVRPEIRIAQ
A0A6I9LW27_BCL2L11      RSPAPMSCDKSTQTPSPPCQAFNHYLSAMASIRQSQEEPADVRPEIRIAQ
                        *****************************       :    :.*  .*  

A0A6I9LW27_BCL2L11      DAQK----------------------------------NW---
A0A6I9LW27_BCL2L11      ELRRIGDEFNESYTRRAEDHPHHPQMVILQLLRFFIRLVWRRH
A0A6I9LW27_BCL2L11      ELRRIGDEFNESYTRRAEDHPHHPQMVILQLLRFFIRLVWRRH
                        : ..                                   *   

© 1998-2022Legal notice